BLASTX nr result
ID: Forsythia23_contig00025378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00025378 (408 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075828.1| PREDICTED: aluminum-activated malate transpo... 66 8e-09 >ref|XP_011075828.1| PREDICTED: aluminum-activated malate transporter 4-like [Sesamum indicum] Length = 582 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -3 Query: 406 NSFEELSEKAKFKDPVDSVDTKPVVGFWTRLFKFICCKD 290 NSFEELSEKA+F +PVDS +TK VVGFW +L K ICCKD Sbjct: 544 NSFEELSEKAQFSEPVDSTETKVVVGFWAKLLKRICCKD 582