BLASTX nr result
ID: Forsythia23_contig00025170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00025170 (438 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224744.1| hypothetical protein PRUPE_ppa024358mg [Prun... 49 3e-06 >ref|XP_007224744.1| hypothetical protein PRUPE_ppa024358mg [Prunus persica] gi|462421680|gb|EMJ25943.1| hypothetical protein PRUPE_ppa024358mg [Prunus persica] Length = 440 Score = 48.5 bits (114), Expect(2) = 3e-06 Identities = 31/87 (35%), Positives = 42/87 (48%), Gaps = 18/87 (20%) Frame = -3 Query: 280 GFETGGRVRGYGDVVTPDMVPWVQQTQPTSSIHRSRRG*DYASLESSFLDLQSKY----- 116 G ET VRG G V P VPW+Q +S + RG DY LES +++LQ +Y Sbjct: 287 GPETNNSVRGEGLGVKPHQVPWIQTKAGSS---KRLRGHDYVHLESQYVELQERYKHDQD 343 Query: 115 -------------KEQRKEIEELRHMI 74 K ++EIEE+R M+ Sbjct: 344 HWRSELKATQELLKHNQQEIEEMRQML 370 Score = 28.9 bits (63), Expect(2) = 3e-06 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 8/58 (13%) Frame = -2 Query: 428 HMRKDKHKSWIDDPSRQ--------IRAKISQELTQLVATHVE*TPELRLQAYVTVRG 279 H R+D+ +SW++ + Q + A++ ++L +LV E R +AYV G Sbjct: 230 HTRRDEDRSWVNLVAEQKYHMKNKTVEAEMQEKLKELVEDECPDNLETRRRAYVEAMG 287