BLASTX nr result
ID: Forsythia23_contig00024298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00024298 (421 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008372815.1| PREDICTED: uncharacterized protein LOC103436... 91 4e-16 ref|XP_004232597.1| PREDICTED: protein transport protein Sec24-l... 57 6e-06 >ref|XP_008372815.1| PREDICTED: uncharacterized protein LOC103436170 [Malus domestica] Length = 534 Score = 90.5 bits (223), Expect = 4e-16 Identities = 53/101 (52%), Positives = 66/101 (65%), Gaps = 5/101 (4%) Frame = -3 Query: 347 DEMLAKADEYLAERANEQQLPEDTLLEEIPVDDPDARLKIMMSVLGVKPRRQIHGLGDGR 168 DEMLA+ ++YL E A + PEDT L EI V D D L I+ VLGVKP +QI GLGDGR Sbjct: 372 DEMLARKEDYLNELAKDY--PEDTPLNEIVVPDQDVGLHILNDVLGVKPGKQIRGLGDGR 429 Query: 167 L*DIG-----TSSNVRHMEKELEEERDARKAADGARTEIEQ 60 + ++G TS R +E+EL EER AR+AAD AR +Q Sbjct: 430 VRELGGSTSRTSLRARQLEEELVEERAARQAADAAREAADQ 470 >ref|XP_004232597.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Solanum lycopersicum] gi|723673366|ref|XP_010316499.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Solanum lycopersicum] Length = 1051 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 420 RHELTRDLTRETAWESVMRIRCGKG 346 RHELTRDLTRETAWESVMRIRCGKG Sbjct: 685 RHELTRDLTRETAWESVMRIRCGKG 709