BLASTX nr result
ID: Forsythia23_contig00024246
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00024246 (379 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12107.1| unnamed protein product [Coffea canephora] 58 2e-06 >emb|CDP12107.1| unnamed protein product [Coffea canephora] Length = 650 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = -3 Query: 92 PAEKEENLGEKLRKLSKRGGHTTPVIPYWR 3 PAEK+ENLGEKL+++ KRGGH+TPV+P+WR Sbjct: 11 PAEKQENLGEKLKRVGKRGGHSTPVVPFWR 40