BLASTX nr result
ID: Forsythia23_contig00024033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00024033 (329 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010325922.1| PREDICTED: cell division protein FtsZ homolo... 56 8e-06 >ref|XP_010325922.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like [Solanum lycopersicum] gi|723727898|ref|XP_010325923.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like [Solanum lycopersicum] gi|723727901|ref|XP_010325924.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like [Solanum lycopersicum] gi|723727904|ref|XP_010325925.1| PREDICTED: cell division protein FtsZ homolog 2-1, chloroplastic-like [Solanum lycopersicum] Length = 478 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = -2 Query: 136 MATCTSPCFIPVDSRKLMGVLTVLGGSVRPSKIVDEKKGLLSIGQ 2 MATCTS F+P D+R+ GVLTVLGG V P KI DEK G L + Q Sbjct: 1 MATCTSAVFMPPDTRRSRGVLTVLGGRVCPLKIQDEKIGYLGVNQ 45