BLASTX nr result
ID: Forsythia23_contig00023898
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00023898 (499 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094299.1| PREDICTED: 40S ribosomal protein S14-3-like ... 73 8e-11 ref|NP_187758.1| 40S ribosomal protein S14-2 [Arabidopsis thalia... 71 2e-10 sp|P93377.1|RS14_TOBAC RecName: Full=40S ribosomal protein S14, ... 71 2e-10 ref|XP_012435087.1| PREDICTED: 40S ribosomal protein S14-2-like ... 71 2e-10 ref|XP_012072104.1| PREDICTED: phospho-N-acetylmuramoyl-pentapep... 71 2e-10 gb|KJB53448.1| hypothetical protein B456_009G400400 [Gossypium r... 71 2e-10 gb|KJB53447.1| hypothetical protein B456_009G400400 [Gossypium r... 71 2e-10 gb|KJB53446.1| hypothetical protein B456_009G400400 [Gossypium r... 71 2e-10 gb|KJB46426.1| hypothetical protein B456_007G368100 [Gossypium r... 71 2e-10 ref|XP_012485784.1| PREDICTED: 40S ribosomal protein S14 [Gossyp... 71 2e-10 gb|AIL48448.1| small subunit ribosomal protein 14, partial [Dipl... 71 2e-10 gb|AIL48443.1| small subunit ribosomal protein 14, partial [Rhab... 71 2e-10 ref|XP_011077844.1| PREDICTED: 40S ribosomal protein S14-3 [Sesa... 71 2e-10 ref|XP_010912312.1| PREDICTED: 40S ribosomal protein S14 [Elaeis... 71 2e-10 ref|XP_010683691.1| PREDICTED: 40S ribosomal protein S14-2 [Beta... 71 2e-10 ref|XP_010558019.1| PREDICTED: 40S ribosomal protein S14-3-like ... 71 2e-10 ref|XP_010534412.1| PREDICTED: 40S ribosomal protein S14-3 [Tare... 71 2e-10 gb|KHG22767.1| 40S ribosomal S14 [Gossypium arboreum] 71 2e-10 gb|KHG06570.1| 40S ribosomal S14 [Gossypium arboreum] 71 2e-10 ref|XP_012472860.1| PREDICTED: 40S ribosomal protein S14-2 [Goss... 71 2e-10 >ref|XP_011094299.1| PREDICTED: 40S ribosomal protein S14-3-like [Sesamum indicum] Length = 150 Score = 72.8 bits (177), Expect = 8e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST Sbjct: 105 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 139 >ref|NP_187758.1| 40S ribosomal protein S14-2 [Arabidopsis thaliana] gi|27734448|sp|Q9CAX6.1|RS142_ARATH RecName: Full=40S ribosomal protein S14-2 gi|12322890|gb|AAG51428.1|AC008153_1 putative 40S ribosomal protein s14; 67401-66292 [Arabidopsis thaliana] gi|21595448|gb|AAM66102.1| putative 40S ribosomal protein S14 [Arabidopsis thaliana] gi|98961087|gb|ABF59027.1| At3g11510 [Arabidopsis thaliana] gi|332641535|gb|AEE75056.1| 40S ribosomal protein S14-2 [Arabidopsis thaliana] Length = 150 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 105 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >sp|P93377.1|RS14_TOBAC RecName: Full=40S ribosomal protein S14, partial [Nicotiana tabacum] gi|1762931|gb|AAC49968.1| ribosomal protein S14, partial [Nicotiana tabacum] Length = 66 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 21 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 55 >ref|XP_012435087.1| PREDICTED: 40S ribosomal protein S14-2-like [Gossypium raimondii] Length = 150 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 105 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >ref|XP_012072104.1| PREDICTED: phospho-N-acetylmuramoyl-pentapeptide-transferase homolog isoform X2 [Jatropha curcas] Length = 626 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 581 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 615 >gb|KJB53448.1| hypothetical protein B456_009G400400 [Gossypium raimondii] Length = 125 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 80 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 114 >gb|KJB53447.1| hypothetical protein B456_009G400400 [Gossypium raimondii] Length = 99 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 54 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 88 >gb|KJB53446.1| hypothetical protein B456_009G400400 [Gossypium raimondii] Length = 92 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 47 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 81 >gb|KJB46426.1| hypothetical protein B456_007G368100 [Gossypium raimondii] Length = 158 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 113 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 147 >ref|XP_012485784.1| PREDICTED: 40S ribosomal protein S14 [Gossypium raimondii] gi|823217952|ref|XP_012441625.1| PREDICTED: 40S ribosomal protein S14 [Gossypium raimondii] gi|763769120|gb|KJB36335.1| hypothetical protein B456_006G153200 [Gossypium raimondii] gi|763786447|gb|KJB53443.1| hypothetical protein B456_009G400400 [Gossypium raimondii] Length = 150 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 105 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >gb|AIL48448.1| small subunit ribosomal protein 14, partial [Diplogastridae gen. 1 sp. 1 EJR-2014] Length = 152 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 107 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 141 >gb|AIL48443.1| small subunit ribosomal protein 14, partial [Rhabditolaimus sp. 1 VS-2014] Length = 152 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 107 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 141 >ref|XP_011077844.1| PREDICTED: 40S ribosomal protein S14-3 [Sesamum indicum] Length = 150 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 105 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >ref|XP_010912312.1| PREDICTED: 40S ribosomal protein S14 [Elaeis guineensis] gi|743818080|ref|XP_010931115.1| PREDICTED: 40S ribosomal protein S14 [Elaeis guineensis] gi|743830177|ref|XP_010934348.1| PREDICTED: 40S ribosomal protein S14 [Elaeis guineensis] Length = 150 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 105 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >ref|XP_010683691.1| PREDICTED: 40S ribosomal protein S14-2 [Beta vulgaris subsp. vulgaris] gi|870855007|gb|KMT06755.1| hypothetical protein BVRB_7g159150 [Beta vulgaris subsp. vulgaris] Length = 150 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 105 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >ref|XP_010558019.1| PREDICTED: 40S ribosomal protein S14-3-like [Tarenaya hassleriana] Length = 150 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 105 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >ref|XP_010534412.1| PREDICTED: 40S ribosomal protein S14-3 [Tarenaya hassleriana] gi|729352083|ref|XP_010543798.1| PREDICTED: 40S ribosomal protein S14-3 [Tarenaya hassleriana] Length = 150 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 105 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >gb|KHG22767.1| 40S ribosomal S14 [Gossypium arboreum] Length = 158 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 113 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 147 >gb|KHG06570.1| 40S ribosomal S14 [Gossypium arboreum] Length = 150 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 105 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >ref|XP_012472860.1| PREDICTED: 40S ribosomal protein S14-2 [Gossypium raimondii] gi|728818725|gb|KHG02898.1| 40S ribosomal S14 [Gossypium arboreum] gi|728847804|gb|KHG27247.1| 40S ribosomal S14 [Gossypium arboreum] gi|763754394|gb|KJB21725.1| hypothetical protein B456_004G010500 [Gossypium raimondii] Length = 150 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 497 KTPGPGAQSALRALARTGMKIGRIEDVTPIPTDST 393 KTPGPGAQSALRALAR+GMKIGRIEDVTPIPTDST Sbjct: 105 KTPGPGAQSALRALARSGMKIGRIEDVTPIPTDST 139