BLASTX nr result
ID: Forsythia23_contig00023874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00023874 (425 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHG01122.1| hypothetical protein F383_00666 [Gossypium arboreum] 57 5e-06 ref|XP_011094358.1| PREDICTED: uncharacterized protein LOC105174... 56 8e-06 >gb|KHG01122.1| hypothetical protein F383_00666 [Gossypium arboreum] Length = 51 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 318 YGFMFGRESAREELSDLIESLRQANSDPASSSPP 419 YGFMFGRESAR+EL DLIESLR+ NS +SSSPP Sbjct: 15 YGFMFGRESARKELGDLIESLRRDNSSSSSSSPP 48 >ref|XP_011094358.1| PREDICTED: uncharacterized protein LOC105174074 [Sesamum indicum] gi|747048540|ref|XP_011070283.1| PREDICTED: uncharacterized protein LOC105155981 [Sesamum indicum] Length = 62 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = +3 Query: 312 FRYGFMFGRESAREELSDLIESLRQANSDPASSSPP 419 F YGFMFGRESAR+EL+DLIE+LR+++SD S++PP Sbjct: 22 FWYGFMFGRESARKELNDLIENLRRSSSDATSTAPP 57