BLASTX nr result
ID: Forsythia23_contig00023399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00023399 (357 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012849342.1| PREDICTED: two-pore potassium channel 3-like... 62 2e-07 ref|XP_011085276.1| PREDICTED: two-pore potassium channel 3-like... 59 1e-06 >ref|XP_012849342.1| PREDICTED: two-pore potassium channel 3-like [Erythranthe guttatus] gi|604315470|gb|EYU28176.1| hypothetical protein MIMGU_mgv1a006396mg [Erythranthe guttata] Length = 445 Score = 61.6 bits (148), Expect = 2e-07 Identities = 38/76 (50%), Positives = 44/76 (57%), Gaps = 5/76 (6%) Frame = -2 Query: 218 MEKEPLVPYINXXXXXXXXXXXXXXXXXP----ENNEITIPPLPLTP-SKELKDRLIFGS 54 MEKEPL+ YI+ E++EITIPPLPLTP S+E KD LIFGS Sbjct: 1 MEKEPLLSYISTRRTQPTTPPPPPPPSLLCPLPEDDEITIPPLPLTPTSREFKDMLIFGS 60 Query: 53 PLTSPSRFKDSSSSTL 6 P S S KDSSS+ L Sbjct: 61 PSASSSHLKDSSSTLL 76 >ref|XP_011085276.1| PREDICTED: two-pore potassium channel 3-like [Sesamum indicum] Length = 442 Score = 58.9 bits (141), Expect = 1e-06 Identities = 39/77 (50%), Positives = 47/77 (61%), Gaps = 5/77 (6%) Frame = -2 Query: 218 MEKEPLVPYINXXXXXXXXXXXXXXXXXPENNEITIPPLPLTP-SKELKDRLIFGSP--- 51 MEKEPL+PY + E++EITIPPL LTP +KELKDRLIFGSP Sbjct: 1 MEKEPLLPYSSPRRPEPPPPPLLCPLP--EDDEITIPPLLLTPPAKELKDRLIFGSPSAS 58 Query: 50 -LTSPSRFKDSSSSTLL 3 +S S+ DS+SS LL Sbjct: 59 ASSSSSQLNDSNSSNLL 75