BLASTX nr result
ID: Forsythia23_contig00023321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00023321 (442 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075350.1| PREDICTED: calcium-transporting ATPase 4, pl... 60 7e-07 ref|XP_007162164.1| hypothetical protein PHAVU_001G129600g [Phas... 57 5e-06 ref|XP_004498043.1| PREDICTED: calcium-transporting ATPase 4, pl... 57 5e-06 ref|XP_012828096.1| PREDICTED: calcium-transporting ATPase 4, pl... 56 8e-06 ref|XP_002322655.2| hypothetical protein POPTR_0016s04240g [Popu... 56 8e-06 >ref|XP_011075350.1| PREDICTED: calcium-transporting ATPase 4, plasma membrane-type-like [Sesamum indicum] Length = 1055 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 442 VSMPIAVVLKCIPVYKKTPNSTQHDGYDPLPSGPDL 335 V MPIAVVLKCIPV K + QH+GYDPLPSGPDL Sbjct: 1019 VGMPIAVVLKCIPVDTKPATAKQHEGYDPLPSGPDL 1054 >ref|XP_007162164.1| hypothetical protein PHAVU_001G129600g [Phaseolus vulgaris] gi|561035628|gb|ESW34158.1| hypothetical protein PHAVU_001G129600g [Phaseolus vulgaris] Length = 1037 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -1 Query: 442 VSMPIAVVLKCIPVYKKTPNSTQHDGYDPLPSGPDL 335 VS+PIAV+LKCIPV K T + HDGYD LPSGP+L Sbjct: 1001 VSIPIAVILKCIPVEKDTTSKQHHDGYDALPSGPEL 1036 >ref|XP_004498043.1| PREDICTED: calcium-transporting ATPase 4, plasma membrane-type [Cicer arietinum] Length = 1034 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -1 Query: 442 VSMPIAVVLKCIPVYKKTPNSTQHDGYDPLPSGPDL 335 +SMPIA +LKCIPV + T N+ HDGY+ LPSGPDL Sbjct: 998 LSMPIAAILKCIPVERDTTNTKHHDGYEALPSGPDL 1033 >ref|XP_012828096.1| PREDICTED: calcium-transporting ATPase 4, plasma membrane-type-like [Erythranthe guttatus] gi|604298702|gb|EYU18704.1| hypothetical protein MIMGU_mgv1a000576mg [Erythranthe guttata] Length = 1062 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/39 (71%), Positives = 29/39 (74%), Gaps = 3/39 (7%) Frame = -1 Query: 442 VSMPIAVVLKCIPVYKKTPN---STQHDGYDPLPSGPDL 335 V MPIAVVLKCIPV K N QHDGY+PLPSGPDL Sbjct: 1023 VGMPIAVVLKCIPVGKSKHNVDSEKQHDGYEPLPSGPDL 1061 >ref|XP_002322655.2| hypothetical protein POPTR_0016s04240g [Populus trichocarpa] gi|550320797|gb|EEF04416.2| hypothetical protein POPTR_0016s04240g [Populus trichocarpa] Length = 1002 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 442 VSMPIAVVLKCIPVYKKTPNSTQHDGYDPLPSGPDL 335 VSMPIAVVLKCIPV ++ P HDGYD LPSGPDL Sbjct: 968 VSMPIAVVLKCIPVERENPK--HHDGYDALPSGPDL 1001