BLASTX nr result
ID: Forsythia23_contig00023280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00023280 (370 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011092354.1| PREDICTED: ankyrin repeat domain-containing ... 56 8e-06 >ref|XP_011092354.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Sesamum indicum] Length = 348 Score = 56.2 bits (134), Expect = 8e-06 Identities = 30/53 (56%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = -1 Query: 157 MSEEIKNSPFRTAEEKSDATESRT-TEATSVETQPGQRRSTPASVAGMPNPFD 2 MSE +K P KSDA S+T E+ S T GQR +TPASVAGMPNPFD Sbjct: 1 MSEAVKTPPASADGNKSDAAGSKTPVESASAGTPSGQRTATPASVAGMPNPFD 53