BLASTX nr result
ID: Forsythia23_contig00023276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00023276 (369 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012838664.1| PREDICTED: receptor-like protein kinase HERK... 65 2e-08 ref|XP_011089398.1| PREDICTED: receptor-like protein kinase HERK... 63 7e-08 >ref|XP_012838664.1| PREDICTED: receptor-like protein kinase HERK 1 [Erythranthe guttatus] gi|604331381|gb|EYU36239.1| hypothetical protein MIMGU_mgv1a001323mg [Erythranthe guttata] Length = 840 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/44 (65%), Positives = 31/44 (70%) Frame = -2 Query: 137 FASMGSGDFRFSIWVVFALCLVCFSVGFDPVDKYYVNCGSSNDV 6 F MG G R SIWV+ L L C S GFDPVDKYY+NCGS NDV Sbjct: 3 FPKMGGGVLRVSIWVLLLLNLACCSRGFDPVDKYYINCGSPNDV 46 >ref|XP_011089398.1| PREDICTED: receptor-like protein kinase HERK 1 [Sesamum indicum] Length = 835 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -2 Query: 137 FASMGSGDFRFSIWVVFALCLVCFSVGFDPVDKYYVNCGSSNDV 6 F M G RFSIWV+ L L C S GFDPVD+YY+NCGSS+DV Sbjct: 3 FVMMDCGVLRFSIWVLLVLNLACCSRGFDPVDQYYINCGSSSDV 46