BLASTX nr result
ID: Forsythia23_contig00021979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00021979 (513 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012844806.1| PREDICTED: methyl-CpG-binding domain-contain... 64 4e-08 ref|XP_011086553.1| PREDICTED: methyl-CpG-binding domain-contain... 61 3e-07 >ref|XP_012844806.1| PREDICTED: methyl-CpG-binding domain-containing protein 9-like [Erythranthe guttatus] Length = 1988 Score = 63.9 bits (154), Expect = 4e-08 Identities = 37/62 (59%), Positives = 42/62 (67%), Gaps = 7/62 (11%) Frame = -1 Query: 222 FFIDLNETPISSPREA---DVGPSGGILVCAVCKKGVPGGRRNGPASEE----WKCFRCL 64 F IDLNETP+ SPREA V S I VC+VC+KGVP GR A+EE +KCFRCL Sbjct: 16 FQIDLNETPMPSPREAFDDAVLGSASISVCSVCRKGVPVGRLPARATEEQRQQFKCFRCL 75 Query: 63 LK 58 LK Sbjct: 76 LK 77 >ref|XP_011086553.1| PREDICTED: methyl-CpG-binding domain-containing protein 9-like [Sesamum indicum] Length = 2124 Score = 60.8 bits (146), Expect = 3e-07 Identities = 35/62 (56%), Positives = 40/62 (64%), Gaps = 7/62 (11%) Frame = -1 Query: 222 FFIDLNETPISSPREA---DVGPSGGILVCAVCKKGVPGGRRNGPASE----EWKCFRCL 64 F IDLNETP+ SPREA V S + VCAVC+KGVP G+ E E+KCFRCL Sbjct: 16 FPIDLNETPMPSPREAVDDTVVGSASVSVCAVCRKGVPVGKVPEKGMEGQRQEFKCFRCL 75 Query: 63 LK 58 LK Sbjct: 76 LK 77