BLASTX nr result
ID: Forsythia23_contig00021884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00021884 (590 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071026.1| PREDICTED: mitochondrial outer membrane prot... 76 1e-11 ref|XP_011086392.1| PREDICTED: mitochondrial outer membrane prot... 75 2e-11 ref|XP_012847717.1| PREDICTED: mitochondrial outer membrane prot... 75 2e-11 emb|CDP00287.1| unnamed protein product [Coffea canephora] 75 2e-11 emb|CAA56601.1| 36kDa porin I [Solanum tuberosum] 74 4e-11 ref|XP_009627246.1| PREDICTED: mitochondrial outer membrane prot... 74 4e-11 emb|CDP00288.1| unnamed protein product [Coffea canephora] 74 4e-11 ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane prot... 74 4e-11 ref|NP_001275134.1| mitochondrial outer membrane protein porin o... 74 4e-11 ref|XP_009772199.1| PREDICTED: mitochondrial outer membrane prot... 74 4e-11 ref|XP_009797869.1| PREDICTED: mitochondrial outer membrane prot... 74 5e-11 ref|XP_010256458.1| PREDICTED: mitochondrial outer membrane prot... 74 7e-11 gb|EPS68383.1| hypothetical protein M569_06388 [Genlisea aurea] 74 7e-11 ref|XP_010096343.1| Mitochondrial outer membrane protein porin o... 73 8e-11 gb|KDO82796.1| hypothetical protein CISIN_1g0238542mg, partial [... 73 8e-11 ref|XP_010066951.1| PREDICTED: mitochondrial outer membrane prot... 73 8e-11 ref|XP_002520135.1| voltage-dependent anion-selective channel, p... 73 8e-11 ref|XP_006483230.1| PREDICTED: mitochondrial outer membrane prot... 73 8e-11 ref|XP_006438620.1| hypothetical protein CICLE_v10032366mg [Citr... 73 8e-11 ref|XP_004297335.1| PREDICTED: mitochondrial outer membrane prot... 73 8e-11 >ref|XP_011071026.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Sesamum indicum] Length = 278 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL+T+SGEVDTRAIEKSAKIGLAVALKP Sbjct: 241 ALIQHEWRPKSLITISGEVDTRAIEKSAKIGLAVALKP 278 >ref|XP_011086392.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa [Sesamum indicum] Length = 278 Score = 75.5 bits (184), Expect = 2e-11 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL+T+SGEVDTRAIEKSAK+GLAVALKP Sbjct: 241 ALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 278 >ref|XP_012847717.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Erythranthe guttatus] gi|604316513|gb|EYU28705.1| hypothetical protein MIMGU_mgv1a011554mg [Erythranthe guttata] Length = 278 Score = 75.5 bits (184), Expect = 2e-11 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL+T+SGEVDTRAIEKSAK+GLAVALKP Sbjct: 241 ALIQHEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 278 >emb|CDP00287.1| unnamed protein product [Coffea canephora] Length = 276 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL+T+SGEVDTRAIEKSAKIGLAVALKP Sbjct: 239 ALIQHEWRPKSLLTISGEVDTRAIEKSAKIGLAVALKP 276 >emb|CAA56601.1| 36kDa porin I [Solanum tuberosum] Length = 276 Score = 74.3 bits (181), Expect = 4e-11 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL T+SGEVDTRAIEKSAKIGLAVALKP Sbjct: 239 ALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|XP_009627246.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa [Nicotiana tomentosiformis] Length = 276 Score = 74.3 bits (181), Expect = 4e-11 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL T+SGEVDTRAIEKSAKIGLAVALKP Sbjct: 239 ALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >emb|CDP00288.1| unnamed protein product [Coffea canephora] Length = 276 Score = 74.3 bits (181), Expect = 4e-11 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL T+SGEVDTRAIEKSAKIGLAVALKP Sbjct: 239 ALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa [Solanum lycopersicum] Length = 276 Score = 74.3 bits (181), Expect = 4e-11 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL T+SGEVDTRAIEKSAKIGLAVALKP Sbjct: 239 ALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|NP_001275134.1| mitochondrial outer membrane protein porin of 36 kDa [Solanum tuberosum] gi|1172556|sp|P42056.2|VDAC2_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 36 kDa; AltName: Full=POM 36; AltName: Full=Voltage-dependent anion-selective channel protein; Short=VDAC gi|515360|emb|CAA56600.1| 36kDA porin II [Solanum tuberosum] Length = 276 Score = 74.3 bits (181), Expect = 4e-11 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL T+SGEVDTRAIEKSAKIGLAVALKP Sbjct: 239 ALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|XP_009772199.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa [Nicotiana sylvestris] gi|161788874|dbj|BAF95071.1| voltage-dependent anion channel [Nicotiana tabacum] Length = 276 Score = 74.3 bits (181), Expect = 4e-11 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL T+SGEVDTRAIEKSAKIGLAVALKP Sbjct: 239 ALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|XP_009797869.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Nicotiana sylvestris] Length = 276 Score = 73.9 bits (180), Expect = 5e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL T+SGEVDTRAIEKSAK+GLAVALKP Sbjct: 239 ALIQHEWRPKSLFTISGEVDTRAIEKSAKVGLAVALKP 276 >ref|XP_010256458.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Nelumbo nucifera] Length = 276 Score = 73.6 bits (179), Expect = 7e-11 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL+T+SGEVDTRAIEKSAK+GLA+ALKP Sbjct: 239 ALIQHEWRPKSLLTISGEVDTRAIEKSAKVGLALALKP 276 >gb|EPS68383.1| hypothetical protein M569_06388 [Genlisea aurea] Length = 278 Score = 73.6 bits (179), Expect = 7e-11 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 A+IQHEWRPKSL+T+SGEVDTRAIEK+AKIGLAVALKP Sbjct: 241 AVIQHEWRPKSLITISGEVDTRAIEKTAKIGLAVALKP 278 >ref|XP_010096343.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis] gi|587874683|gb|EXB63818.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis] Length = 276 Score = 73.2 bits (178), Expect = 8e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL T+SGEVDTRAIEKSAKIGLA+ALKP Sbjct: 239 ALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >gb|KDO82796.1| hypothetical protein CISIN_1g0238542mg, partial [Citrus sinensis] gi|641864111|gb|KDO82797.1| hypothetical protein CISIN_1g0238542mg, partial [Citrus sinensis] Length = 101 Score = 73.2 bits (178), Expect = 8e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL T+SGEVDTRAIEKSAKIGLA+ALKP Sbjct: 64 ALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 101 >ref|XP_010066951.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa [Eucalyptus grandis] gi|629099241|gb|KCW65006.1| hypothetical protein EUGRSUZ_G02544 [Eucalyptus grandis] Length = 276 Score = 73.2 bits (178), Expect = 8e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL T+SGEVDTRAIEKSAKIGLA+ALKP Sbjct: 239 ALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >ref|XP_002520135.1| voltage-dependent anion-selective channel, putative [Ricinus communis] gi|223540627|gb|EEF42190.1| voltage-dependent anion-selective channel, putative [Ricinus communis] Length = 276 Score = 73.2 bits (178), Expect = 8e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL T+SGEVDTRAIEKSAKIGLA+ALKP Sbjct: 239 ALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >ref|XP_006483230.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Citrus sinensis] Length = 276 Score = 73.2 bits (178), Expect = 8e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL T+SGEVDTRAIEKSAKIGLA+ALKP Sbjct: 239 ALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >ref|XP_006438620.1| hypothetical protein CICLE_v10032366mg [Citrus clementina] gi|557540816|gb|ESR51860.1| hypothetical protein CICLE_v10032366mg [Citrus clementina] Length = 276 Score = 73.2 bits (178), Expect = 8e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL T+SGEVDTRAIEKSAKIGLA+ALKP Sbjct: 239 ALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >ref|XP_004297335.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Fragaria vesca subsp. vesca] Length = 276 Score = 73.2 bits (178), Expect = 8e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 588 ALIQHEWRPKSLVTVSGEVDTRAIEKSAKIGLAVALKP 475 ALIQHEWRPKSL T+SGEVDTRAIEKSAKIGLA+ALKP Sbjct: 239 ALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276