BLASTX nr result
ID: Forsythia23_contig00021672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00021672 (401 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012459121.1| PREDICTED: putative glucose-6-phosphate 1-ep... 60 6e-07 gb|KJB75905.1| hypothetical protein B456_012G064600, partial [Go... 60 6e-07 ref|XP_007031597.1| Aldose 1-epimerase family protein isoform 1 ... 60 6e-07 >ref|XP_012459121.1| PREDICTED: putative glucose-6-phosphate 1-epimerase isoform X1 [Gossypium raimondii] Length = 337 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +1 Query: 271 LEWRKGKVHPIGKSLREKLRKITMPVNMIQDGDGSPRIILSEP 399 LEWRKGKV+P S+R +LR MP+N++ D DG PRIIL+EP Sbjct: 9 LEWRKGKVNPFSSSIRARLRPKAMPMNLVHDVDGLPRIILTEP 51 >gb|KJB75905.1| hypothetical protein B456_012G064600, partial [Gossypium raimondii] Length = 338 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +1 Query: 271 LEWRKGKVHPIGKSLREKLRKITMPVNMIQDGDGSPRIILSEP 399 LEWRKGKV+P S+R +LR MP+N++ D DG PRIIL+EP Sbjct: 10 LEWRKGKVNPFSSSIRARLRPKAMPMNLVHDVDGLPRIILTEP 52 >ref|XP_007031597.1| Aldose 1-epimerase family protein isoform 1 [Theobroma cacao] gi|508710626|gb|EOY02523.1| Aldose 1-epimerase family protein isoform 1 [Theobroma cacao] Length = 351 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = +1 Query: 271 LEWRKGKVHPIGKSLREKLRKITMPVNMIQDGDGSPRIILSEP 399 LEWRKGKV+P S+R +LR MP+N+++D DG PRIIL+EP Sbjct: 23 LEWRKGKVNPFVSSIRARLRPKAMPLNIVRDADGLPRIILTEP 65