BLASTX nr result
ID: Forsythia23_contig00021618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00021618 (387 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075228.1| PREDICTED: calcium-dependent protein kinase ... 111 2e-22 gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var.... 107 2e-21 gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] 107 4e-21 ref|XP_010667055.1| PREDICTED: calcium-dependent protein kinase ... 106 5e-21 ref|XP_010102356.1| Calcium-dependent protein kinase 8 [Morus no... 105 9e-21 ref|XP_008804559.1| PREDICTED: calcium-dependent protein kinase ... 105 1e-20 emb|CDP20654.1| unnamed protein product [Coffea canephora] 105 1e-20 ref|XP_008344697.1| PREDICTED: calcium-dependent protein kinase ... 105 1e-20 gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium a... 105 2e-20 ref|XP_011090028.1| PREDICTED: calcium-dependent protein kinase ... 104 2e-20 ref|XP_011078890.1| PREDICTED: calcium-dependent protein kinase ... 104 2e-20 ref|XP_009597085.1| PREDICTED: calcium-dependent protein kinase ... 104 2e-20 gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tab... 104 2e-20 ref|XP_012844662.1| PREDICTED: calcium-dependent protein kinase ... 104 3e-20 ref|XP_009603083.1| PREDICTED: calcium-dependent protein kinase ... 103 3e-20 ref|XP_009366097.1| PREDICTED: calcium-dependent protein kinase ... 103 3e-20 ref|XP_012470708.1| PREDICTED: calcium-dependent protein kinase ... 103 5e-20 ref|XP_010931028.1| PREDICTED: calcium-dependent protein kinase ... 103 5e-20 ref|XP_009767418.1| PREDICTED: calcium-dependent protein kinase ... 103 5e-20 ref|XP_008450417.1| PREDICTED: calcium-dependent protein kinase ... 103 5e-20 >ref|XP_011075228.1| PREDICTED: calcium-dependent protein kinase 32 isoform X1 [Sesamum indicum] Length = 530 Score = 111 bits (277), Expect = 2e-22 Identities = 54/57 (94%), Positives = 55/57 (96%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVDTDKDGRISY+EFAAMMKAGTDWRKASRQYSRE YNSLSLKLMKDGSLQM NEGR Sbjct: 474 DVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSLQMGNEGR 530 >gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var. multicaulis] Length = 532 Score = 107 bits (268), Expect = 2e-21 Identities = 51/57 (89%), Positives = 56/57 (98%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVDTDKDGRISY+EFAAMMKAGTDWRKASRQYSRE +NSLSLKLM+DGSLQ++NEGR Sbjct: 476 DVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQLTNEGR 532 >gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] Length = 534 Score = 107 bits (266), Expect = 4e-21 Identities = 51/57 (89%), Positives = 55/57 (96%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVDTDKDGRISY EFAAMMKAGTDWRKASRQYSRE +N+LSLKLM+DGSLQM+NEGR Sbjct: 478 DVDTDKDGRISYDEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMRDGSLQMNNEGR 534 >ref|XP_010667055.1| PREDICTED: calcium-dependent protein kinase 8-like [Beta vulgaris subsp. vulgaris] gi|870842141|gb|KMS95633.1| hypothetical protein BVRB_006440 [Beta vulgaris subsp. vulgaris] Length = 529 Score = 106 bits (265), Expect = 5e-21 Identities = 51/57 (89%), Positives = 55/57 (96%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVDTDKDGRISY+EFAAMMKAGTDWRKASRQYSRE +N+LSLKLMKDGSLQ +NEGR Sbjct: 473 DVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQSANEGR 529 >ref|XP_010102356.1| Calcium-dependent protein kinase 8 [Morus notabilis] gi|587905126|gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] Length = 579 Score = 105 bits (263), Expect = 9e-21 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEG 218 DVDTDKDGRISY+EFAAMMKAGTDWRKASRQYSRE +NSLSLKLM+DGSLQ++NEG Sbjct: 476 DVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQLTNEG 531 >ref|XP_008804559.1| PREDICTED: calcium-dependent protein kinase 32-like [Phoenix dactylifera] Length = 531 Score = 105 bits (262), Expect = 1e-20 Identities = 50/57 (87%), Positives = 55/57 (96%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVDTDKDGRISY+EFA MMKAGTDWRKASRQYSRE +NSLSLKLMKDGSLQ+++EGR Sbjct: 475 DVDTDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQLTSEGR 531 >emb|CDP20654.1| unnamed protein product [Coffea canephora] Length = 532 Score = 105 bits (262), Expect = 1e-20 Identities = 50/57 (87%), Positives = 55/57 (96%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVD DKDGRISY+EFAAMMKAGTDWRKASRQYSRE +NSLSLKLM+DGSLQ++NEGR Sbjct: 476 DVDIDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQLANEGR 532 >ref|XP_008344697.1| PREDICTED: calcium-dependent protein kinase 8-like [Malus domestica] Length = 533 Score = 105 bits (262), Expect = 1e-20 Identities = 49/57 (85%), Positives = 56/57 (98%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVDTDKDGRISY+EFAAMMKAGTDWRKASRQYSRE +NS+SLKLM++GSLQ++NEGR Sbjct: 477 DVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSISLKLMREGSLQLANEGR 533 >gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium album] Length = 529 Score = 105 bits (261), Expect = 2e-20 Identities = 50/57 (87%), Positives = 55/57 (96%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVDTDKDGRISY+EFAAMMKAGTDWRKASRQYSRE +N+LSLKL+KDGSLQ +NEGR Sbjct: 473 DVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLIKDGSLQSANEGR 529 >ref|XP_011090028.1| PREDICTED: calcium-dependent protein kinase 8-like [Sesamum indicum] Length = 533 Score = 104 bits (260), Expect = 2e-20 Identities = 49/57 (85%), Positives = 55/57 (96%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVDTDKDGRISY+EFA MMKAGTDWRKASRQYSRE +NSLSLKLM+DGSL+++NEGR Sbjct: 477 DVDTDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLKLANEGR 533 >ref|XP_011078890.1| PREDICTED: calcium-dependent protein kinase 32-like [Sesamum indicum] Length = 525 Score = 104 bits (260), Expect = 2e-20 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSN 224 DVDTDKDGRISY+EFAAMMKAGTDWRKASRQYSRE YNSLSLKLMKDGSL MSN Sbjct: 472 DVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSLNMSN 525 >ref|XP_009597085.1| PREDICTED: calcium-dependent protein kinase 32-like [Nicotiana tomentosiformis] Length = 530 Score = 104 bits (260), Expect = 2e-20 Identities = 51/57 (89%), Positives = 52/57 (91%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVDTDKDGRISY EF+ MMK GTDWRKASRQYSRE YNSLSLKLMKDGSLQMSNE R Sbjct: 474 DVDTDKDGRISYDEFSTMMKTGTDWRKASRQYSRERYNSLSLKLMKDGSLQMSNETR 530 >gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tabacum] Length = 530 Score = 104 bits (260), Expect = 2e-20 Identities = 51/57 (89%), Positives = 52/57 (91%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVDTDKDGRISY EF+ MMK GTDWRKASRQYSRE YNSLSLKLMKDGSLQMSNE R Sbjct: 474 DVDTDKDGRISYDEFSTMMKTGTDWRKASRQYSRERYNSLSLKLMKDGSLQMSNETR 530 >ref|XP_012844662.1| PREDICTED: calcium-dependent protein kinase 8-like [Erythranthe guttatus] gi|604320415|gb|EYU31372.1| hypothetical protein MIMGU_mgv1a004319mg [Erythranthe guttata] Length = 533 Score = 104 bits (259), Expect = 3e-20 Identities = 49/57 (85%), Positives = 55/57 (96%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVDTDKDGRISY+EFA+MMKAGTDWRKASRQYSRE +NSLSLKLMK+GSL ++NEGR Sbjct: 477 DVDTDKDGRISYEEFASMMKAGTDWRKASRQYSRERFNSLSLKLMKEGSLHLANEGR 533 >ref|XP_009603083.1| PREDICTED: calcium-dependent protein kinase 8-like [Nicotiana tomentosiformis] Length = 535 Score = 103 bits (258), Expect = 3e-20 Identities = 49/57 (85%), Positives = 54/57 (94%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVDTDKDGRISY+EFAAMMKAGTDWRKASRQYSRE +NSLSLKLM+DGSLQ+ NE + Sbjct: 479 DVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQLGNEAK 535 >ref|XP_009366097.1| PREDICTED: calcium-dependent protein kinase 8-like [Pyrus x bretschneideri] Length = 533 Score = 103 bits (258), Expect = 3e-20 Identities = 48/57 (84%), Positives = 55/57 (96%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVDTDKDGRISY+EFA MMKAGTDWRKASRQYSRE +NS+SLKLM++GSLQ++NEGR Sbjct: 477 DVDTDKDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSISLKLMREGSLQLANEGR 533 >ref|XP_012470708.1| PREDICTED: calcium-dependent protein kinase 32-like [Gossypium raimondii] gi|763751895|gb|KJB19283.1| hypothetical protein B456_003G092900 [Gossypium raimondii] Length = 535 Score = 103 bits (257), Expect = 5e-20 Identities = 50/57 (87%), Positives = 53/57 (92%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVDTDKDGRISY EFA MMKAGTDWRKASRQYSRE +N+LSLKLMKDGSLQM+NE R Sbjct: 479 DVDTDKDGRISYDEFAVMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQMNNEPR 535 >ref|XP_010931028.1| PREDICTED: calcium-dependent protein kinase 32 [Elaeis guineensis] Length = 532 Score = 103 bits (257), Expect = 5e-20 Identities = 49/57 (85%), Positives = 54/57 (94%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVDTDKDGRISY+EFA MMKAGTDWRKASRQYSRE +NSLSLKLMKDG LQ+++EGR Sbjct: 476 DVDTDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGCLQLASEGR 532 >ref|XP_009767418.1| PREDICTED: calcium-dependent protein kinase 32-like [Nicotiana sylvestris] Length = 530 Score = 103 bits (257), Expect = 5e-20 Identities = 50/57 (87%), Positives = 52/57 (91%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVDTDKDGRISY EF+ MMK GTDWRKASRQYSRE YNSLSLKLMKDGSLQM+NE R Sbjct: 474 DVDTDKDGRISYDEFSTMMKTGTDWRKASRQYSRERYNSLSLKLMKDGSLQMNNETR 530 >ref|XP_008450417.1| PREDICTED: calcium-dependent protein kinase 8-like [Cucumis melo] Length = 531 Score = 103 bits (257), Expect = 5e-20 Identities = 49/57 (85%), Positives = 54/57 (94%) Frame = -3 Query: 385 DVDTDKDGRISYKEFAAMMKAGTDWRKASRQYSRECYNSLSLKLMKDGSLQMSNEGR 215 DVDTDKDGRISY+EFAAMMKAGTDWRKASRQYSRE +NSLSLKLM+DGSL ++NE R Sbjct: 475 DVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLHLTNEAR 531