BLASTX nr result
ID: Forsythia23_contig00020968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00020968 (544 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009600670.1| PREDICTED: receptor-like serine/threonine-pr... 56 8e-06 >ref|XP_009600670.1| PREDICTED: receptor-like serine/threonine-protein kinase ALE2 [Nicotiana tomentosiformis] Length = 885 Score = 56.2 bits (134), Expect = 8e-06 Identities = 36/80 (45%), Positives = 48/80 (60%), Gaps = 2/80 (2%) Frame = +2 Query: 311 FLAVEFFAILCAFTIQQSTGIGLHSL-SAASVLFRFKVKTPDLRLHGTR-LRLALLQNDL 484 F ++F ILC F++Q S G L SL +AAS +F+FK D H R LRL+L + DL Sbjct: 7 FTLLKFLVILCGFSVQLSAGFDLLSLKNAASAIFKFKDGRLDRSFHRNRGLRLSLRRQDL 66 Query: 485 APSPTPASSWQKTHGNFASA 544 +P PT S +K H FA+A Sbjct: 67 SPLPT---SIRKRHDTFAAA 83