BLASTX nr result
ID: Forsythia23_contig00020965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00020965 (507 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071237.1| PREDICTED: uncharacterized protein LOC105156... 69 2e-09 >ref|XP_011071237.1| PREDICTED: uncharacterized protein LOC105156713 [Sesamum indicum] Length = 240 Score = 68.6 bits (166), Expect = 2e-09 Identities = 38/75 (50%), Positives = 48/75 (64%), Gaps = 1/75 (1%) Frame = -3 Query: 505 DGFSNPLKSVSGIITGMFKGHPNANV-QEVTKHVSTKQVSTKQREILEPTSIPSLKIPGF 329 DG SNPL+SV GII G FKG + NV Q+V K Q S Q+++ EPT +P LKIP Sbjct: 170 DGLSNPLRSVGGIIGGFFKGRRSVNVVQDVIK-----QASEMQKQVTEPTYLPGLKIPDL 224 Query: 328 PIEHLLGFYSSEDED 284 P L GF +S+DE+ Sbjct: 225 PHLELPGFDTSDDEE 239