BLASTX nr result
ID: Forsythia23_contig00020764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00020764 (487 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081489.1| PREDICTED: hepatoma-derived growth factor-re... 56 8e-06 >ref|XP_011081489.1| PREDICTED: hepatoma-derived growth factor-related protein 2 [Sesamum indicum] gi|747069395|ref|XP_011081490.1| PREDICTED: hepatoma-derived growth factor-related protein 2 [Sesamum indicum] Length = 895 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -1 Query: 481 LKETNHVKEKTTNSAKMSEIKKGKSQDKSKPPESETKSGKKRRR 350 +KET+ +KEK SAK SE+ KGKS D +K ESE+KSGKKRRR Sbjct: 852 VKETDRMKEKRAESAKSSEMVKGKSTDTAKSRESESKSGKKRRR 895