BLASTX nr result
ID: Forsythia23_contig00020744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00020744 (529 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008372815.1| PREDICTED: uncharacterized protein LOC103436... 49 3e-09 >ref|XP_008372815.1| PREDICTED: uncharacterized protein LOC103436170 [Malus domestica] Length = 534 Score = 48.5 bits (114), Expect(3) = 3e-09 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = +1 Query: 118 EDTPLEEILVDDPDAGLQIMMSVLGVKNGSQICGLG 225 EDTPL EI+V D D GL I+ VLGVK G QI GLG Sbjct: 391 EDTPLNEIVVPDQDVGLHILNDVLGVKPGKQIRGLG 426 Score = 30.0 bits (66), Expect(3) = 3e-09 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 251 TSSNVHQMEKELEEQRAARKTAHTAQIEIEQKQV 352 TS Q+E+EL E+RAAR+ A A+ +Q+ V Sbjct: 440 TSLRARQLEEELVEERAARQAADAAREAADQRIV 473 Score = 28.5 bits (62), Expect(3) = 3e-09 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 384 LQSWHHSMQQLCRQVPGFDLP 446 +Q+W HSM L +VPG++ P Sbjct: 490 MQTWQHSMVDLAARVPGWEPP 510