BLASTX nr result
ID: Forsythia23_contig00019497
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00019497 (341 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011092035.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 62 1e-07 >ref|XP_011092035.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Sesamum indicum] Length = 697 Score = 62.0 bits (149), Expect = 1e-07 Identities = 37/77 (48%), Positives = 46/77 (59%) Frame = -2 Query: 232 MLSRSHFQLHSRTRFRFLSISSPFLHNFSPIPKFPTKSRFRQPIPLIIRNSSSTPNSGSI 53 ML FQLH+R+RF LS+SSPF + + +P TK + R I + S SI Sbjct: 1 MLLHRPFQLHARSRFSLLSLSSPFRRSITYLPNSHTKLQRRSVIRI----------SASI 50 Query: 52 TAKPSSELRNKPKNSEP 2 TAKPSSELR K K+SEP Sbjct: 51 TAKPSSELRKKHKSSEP 67