BLASTX nr result
ID: Forsythia23_contig00019290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00019290 (373 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090898.1| PREDICTED: uncharacterized protein LOC105171... 57 6e-06 ref|XP_012858503.1| PREDICTED: uncharacterized protein LOC105977... 57 6e-06 >ref|XP_011090898.1| PREDICTED: uncharacterized protein LOC105171465 [Sesamum indicum] Length = 210 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 122 MGTEVLRPQDCLVERFRVSPAGFHRRRNFSGYGNL 18 MGTEVLRPQD L +RFR PA F RRRNF G GNL Sbjct: 1 MGTEVLRPQDLLADRFRAPPASFQRRRNFPGNGNL 35 >ref|XP_012858503.1| PREDICTED: uncharacterized protein LOC105977696 [Erythranthe guttatus] gi|604345279|gb|EYU43861.1| hypothetical protein MIMGU_mgv1a013946mg [Erythranthe guttata] Length = 205 Score = 56.6 bits (135), Expect = 6e-06 Identities = 30/43 (69%), Positives = 30/43 (69%), Gaps = 3/43 (6%) Frame = -3 Query: 122 MGTEVLRPQDCLVERFRVSPAGFHRRRNFSGYG---NLIANTK 3 MGTEVLRPQD LVERF V PA FHRRRNF G NL N K Sbjct: 1 MGTEVLRPQDLLVERFHVPPASFHRRRNFPATGAISNLNINRK 43