BLASTX nr result
ID: Forsythia23_contig00019196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00019196 (411 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010089118.1| putative phospholipid hydroperoxide glutathi... 109 8e-22 emb|CDP09749.1| unnamed protein product [Coffea canephora] 109 8e-22 gb|EMT04066.1| Putative phospholipid hydroperoxide glutathione p... 109 8e-22 gb|ACG45465.1| phospholipid hydroperoxide glutathione peroxidase... 108 1e-21 gb|ACF84693.1| unknown [Zea mays] gi|413923369|gb|AFW63301.1| gl... 108 1e-21 ref|NP_001105091.1| GP protein [Zea mays] gi|22268405|gb|AAM8884... 108 1e-21 ref|XP_008775339.1| PREDICTED: probable phospholipid hydroperoxi... 107 2e-21 ref|XP_003570046.1| PREDICTED: probable phospholipid hydroperoxi... 107 2e-21 gb|AHN92204.1| glutathione peroxidase [Punica granatum] 107 3e-21 ref|XP_012854299.1| PREDICTED: probable phospholipid hydroperoxi... 107 4e-21 ref|XP_012476117.1| PREDICTED: probable phospholipid hydroperoxi... 106 5e-21 ref|XP_006827674.1| PREDICTED: probable phospholipid hydroperoxi... 106 5e-21 emb|CAJ43709.1| glutathion peroxidase [Plantago major] 106 5e-21 ref|XP_011072526.1| PREDICTED: probable phospholipid hydroperoxi... 105 9e-21 ref|XP_011072518.1| PREDICTED: probable phospholipid hydroperoxi... 105 9e-21 gb|AGM34860.1| glutathione peroxidase, partial [Eleutherococcus ... 105 9e-21 ref|XP_010255411.1| PREDICTED: probable phospholipid hydroperoxi... 105 1e-20 dbj|BAC55016.1| phospholipid hydroperoxide glutathione peroxidas... 105 1e-20 dbj|BAJ84899.1| predicted protein [Hordeum vulgare subsp. vulgar... 105 1e-20 emb|CAB59893.1| GPX12Hv, glutathione peroxidase-like protein [Ho... 105 1e-20 >ref|XP_010089118.1| putative phospholipid hydroperoxide glutathione peroxidase 6 [Morus notabilis] gi|587846925|gb|EXB37365.1| putative phospholipid hydroperoxide glutathione peroxidase 6 [Morus notabilis] Length = 237 Score = 109 bits (272), Expect = 8e-22 Identities = 52/59 (88%), Positives = 58/59 (98%) Frame = -3 Query: 409 SAPIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLLEKA 233 +APIYKFLKSSKG LFGD+IKWNF+KFLVDKEG+VVDR+APTTSPLSIEK+IKKLLEKA Sbjct: 179 AAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKEGNVVDRYAPTTSPLSIEKDIKKLLEKA 237 >emb|CDP09749.1| unnamed protein product [Coffea canephora] Length = 169 Score = 109 bits (272), Expect = 8e-22 Identities = 50/59 (84%), Positives = 58/59 (98%) Frame = -3 Query: 409 SAPIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLLEKA 233 +AP+YKFLKSSKG LFGD+IKWNF+KFLVDKEGHVVDR+APTTSPLSIE+++KKLLEKA Sbjct: 111 AAPLYKFLKSSKGGLFGDSIKWNFSKFLVDKEGHVVDRYAPTTSPLSIEEDVKKLLEKA 169 >gb|EMT04066.1| Putative phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial [Aegilops tauschii] Length = 169 Score = 109 bits (272), Expect = 8e-22 Identities = 51/55 (92%), Positives = 55/55 (100%) Frame = -3 Query: 406 APIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLL 242 AP+YKFLKSSKGSLFGDNIKWNF+KFLVDKEGHVVDR+APTTSPLSIEK+IKKLL Sbjct: 112 APVYKFLKSSKGSLFGDNIKWNFSKFLVDKEGHVVDRYAPTTSPLSIEKDIKKLL 166 >gb|ACG45465.1| phospholipid hydroperoxide glutathione peroxidase [Zea mays] Length = 246 Score = 108 bits (270), Expect = 1e-21 Identities = 51/56 (91%), Positives = 56/56 (100%) Frame = -3 Query: 409 SAPIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLL 242 +APIYKFLKSSKGSLFGDNIKWNF+KFLVDKEGHVV+R+APTTSPLSIEK+IKKLL Sbjct: 188 TAPIYKFLKSSKGSLFGDNIKWNFSKFLVDKEGHVVERYAPTTSPLSIEKDIKKLL 243 >gb|ACF84693.1| unknown [Zea mays] gi|413923369|gb|AFW63301.1| glutathione peroxidase [Zea mays] Length = 246 Score = 108 bits (270), Expect = 1e-21 Identities = 51/56 (91%), Positives = 56/56 (100%) Frame = -3 Query: 409 SAPIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLL 242 +APIYKFLKSSKGSLFGDNIKWNF+KFLVDKEGHVV+R+APTTSPLSIEK+IKKLL Sbjct: 188 TAPIYKFLKSSKGSLFGDNIKWNFSKFLVDKEGHVVERYAPTTSPLSIEKDIKKLL 243 >ref|NP_001105091.1| GP protein [Zea mays] gi|22268405|gb|AAM88847.2|AF520911_1 putative glutathione peroxidase [Zea mays] Length = 168 Score = 108 bits (270), Expect = 1e-21 Identities = 51/56 (91%), Positives = 56/56 (100%) Frame = -3 Query: 409 SAPIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLL 242 +APIYKFLKSSKGSLFGDNIKWNF+KFLVDKEGHVV+R+APTTSPLSIEK+IKKLL Sbjct: 110 TAPIYKFLKSSKGSLFGDNIKWNFSKFLVDKEGHVVERYAPTTSPLSIEKDIKKLL 165 >ref|XP_008775339.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Phoenix dactylifera] Length = 248 Score = 107 bits (268), Expect = 2e-21 Identities = 50/56 (89%), Positives = 56/56 (100%) Frame = -3 Query: 409 SAPIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLL 242 +APIYKFLKSSKGSLFGD+IKWNF+KFLVDKEGHVVDR+APTTSPLSIEK++KKLL Sbjct: 190 AAPIYKFLKSSKGSLFGDSIKWNFSKFLVDKEGHVVDRYAPTTSPLSIEKDVKKLL 245 >ref|XP_003570046.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Brachypodium distachyon] Length = 240 Score = 107 bits (268), Expect = 2e-21 Identities = 49/55 (89%), Positives = 55/55 (100%) Frame = -3 Query: 406 APIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLL 242 APIYKFLKSSKGS+FGDNIKWNF+KFL+DKEGHVVDR+APTTSPLSIEK++KKLL Sbjct: 183 APIYKFLKSSKGSIFGDNIKWNFSKFLIDKEGHVVDRYAPTTSPLSIEKDLKKLL 237 >gb|AHN92204.1| glutathione peroxidase [Punica granatum] Length = 167 Score = 107 bits (267), Expect = 3e-21 Identities = 50/58 (86%), Positives = 56/58 (96%) Frame = -3 Query: 409 SAPIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLLEK 236 +AP+YKFLKSSKG L GD+IKWNF+KFLVDKEGHVVDR+APTTSPLSIEK+IKKLLEK Sbjct: 109 TAPLYKFLKSSKGGLLGDSIKWNFSKFLVDKEGHVVDRYAPTTSPLSIEKDIKKLLEK 166 >ref|XP_012854299.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Erythranthe guttatus] gi|604304136|gb|EYU23486.1| hypothetical protein MIMGU_mgv1a015049mg [Erythranthe guttata] Length = 169 Score = 107 bits (266), Expect = 4e-21 Identities = 50/59 (84%), Positives = 57/59 (96%) Frame = -3 Query: 409 SAPIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLLEKA 233 +APIYK++KS KGSLFGDNIKWNF+KFLVDKEG VVDR+APTT+PLSIEK+IKKLLEKA Sbjct: 111 AAPIYKYMKSIKGSLFGDNIKWNFSKFLVDKEGQVVDRYAPTTTPLSIEKDIKKLLEKA 169 >ref|XP_012476117.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Gossypium raimondii] gi|823152586|ref|XP_012476118.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Gossypium raimondii] gi|763758468|gb|KJB25799.1| hypothetical protein B456_004G211400 [Gossypium raimondii] Length = 166 Score = 106 bits (265), Expect = 5e-21 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = -3 Query: 409 SAPIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLL 242 +APIYKFLKSSKG LFGD+IKWNF+KFLVDKEGHVVDR+APTTSPLSIEK+IKKLL Sbjct: 110 AAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKEGHVVDRYAPTTSPLSIEKDIKKLL 165 >ref|XP_006827674.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Amborella trichopoda] gi|548832294|gb|ERM95090.1| hypothetical protein AMTR_s00009p00255140 [Amborella trichopoda] Length = 254 Score = 106 bits (265), Expect = 5e-21 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = -3 Query: 409 SAPIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLL 242 + P+YKFLKSSKG LFGDNIKWNF+KFLVDKEGHVVDR+APTTSPLSIEK+IKKLL Sbjct: 196 ATPVYKFLKSSKGGLFGDNIKWNFSKFLVDKEGHVVDRYAPTTSPLSIEKDIKKLL 251 >emb|CAJ43709.1| glutathion peroxidase [Plantago major] Length = 168 Score = 106 bits (265), Expect = 5e-21 Identities = 50/59 (84%), Positives = 56/59 (94%) Frame = -3 Query: 409 SAPIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLLEKA 233 +APIYKFLKS+KG LFGD IKWNF+KFLVDKEG VVDR+APTTSPLSIEK++KKLLEKA Sbjct: 110 AAPIYKFLKSAKGGLFGDGIKWNFSKFLVDKEGKVVDRYAPTTSPLSIEKDVKKLLEKA 168 >ref|XP_011072526.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase isoform X2 [Sesamum indicum] Length = 169 Score = 105 bits (263), Expect = 9e-21 Identities = 49/59 (83%), Positives = 57/59 (96%) Frame = -3 Query: 409 SAPIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLLEKA 233 +AP+YK+LKS+KG LFGD+IKWNF+KFLVDKEG VVDR+APTTSPLSIEK+IKKLLEKA Sbjct: 111 AAPLYKYLKSAKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLEKA 169 >ref|XP_011072518.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase isoform X1 [Sesamum indicum] Length = 239 Score = 105 bits (263), Expect = 9e-21 Identities = 49/59 (83%), Positives = 57/59 (96%) Frame = -3 Query: 409 SAPIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLLEKA 233 +AP+YK+LKS+KG LFGD+IKWNF+KFLVDKEG VVDR+APTTSPLSIEK+IKKLLEKA Sbjct: 181 AAPLYKYLKSAKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLEKA 239 >gb|AGM34860.1| glutathione peroxidase, partial [Eleutherococcus senticosus] Length = 169 Score = 105 bits (263), Expect = 9e-21 Identities = 49/59 (83%), Positives = 57/59 (96%) Frame = -3 Query: 409 SAPIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLLEKA 233 +AP+YK+LKSSKG LFGD IKWNF+KFLVDK+G+VVDR+APTTSPLSIEK+IKKLLEKA Sbjct: 111 AAPLYKYLKSSKGGLFGDGIKWNFSKFLVDKDGNVVDRYAPTTSPLSIEKDIKKLLEKA 169 >ref|XP_010255411.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Nelumbo nucifera] Length = 170 Score = 105 bits (262), Expect = 1e-20 Identities = 48/56 (85%), Positives = 55/56 (98%) Frame = -3 Query: 409 SAPIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLL 242 +APIYKFLKSSKG +FGD+IKWNF+KFLVDKEGHV+DR+APTTSPLSIEK+IKKLL Sbjct: 112 AAPIYKFLKSSKGGIFGDSIKWNFSKFLVDKEGHVIDRYAPTTSPLSIEKDIKKLL 167 >dbj|BAC55016.1| phospholipid hydroperoxide glutathione peroxidase-like protein [Hordeum vulgare] Length = 169 Score = 105 bits (262), Expect = 1e-20 Identities = 49/55 (89%), Positives = 55/55 (100%) Frame = -3 Query: 406 APIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLL 242 AP+YKFLKSSKGSLFGDNIKWNF+KFLVDK+G+VVDR+APTTSPLSIEK+IKKLL Sbjct: 112 APVYKFLKSSKGSLFGDNIKWNFSKFLVDKDGNVVDRYAPTTSPLSIEKDIKKLL 166 >dbj|BAJ84899.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326508822|dbj|BAJ86804.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 237 Score = 105 bits (262), Expect = 1e-20 Identities = 49/55 (89%), Positives = 55/55 (100%) Frame = -3 Query: 406 APIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLL 242 AP+YKFLKSSKGSLFGDNIKWNF+KFLVDK+G+VVDR+APTTSPLSIEK+IKKLL Sbjct: 180 APVYKFLKSSKGSLFGDNIKWNFSKFLVDKDGNVVDRYAPTTSPLSIEKDIKKLL 234 >emb|CAB59893.1| GPX12Hv, glutathione peroxidase-like protein [Hordeum vulgare subsp. vulgare] Length = 237 Score = 105 bits (262), Expect = 1e-20 Identities = 49/55 (89%), Positives = 55/55 (100%) Frame = -3 Query: 406 APIYKFLKSSKGSLFGDNIKWNFAKFLVDKEGHVVDRHAPTTSPLSIEKNIKKLL 242 AP+YKFLKSSKGSLFGDNIKWNF+KFLVDK+G+VVDR+APTTSPLSIEK+IKKLL Sbjct: 180 APVYKFLKSSKGSLFGDNIKWNFSKFLVDKDGNVVDRYAPTTSPLSIEKDIKKLL 234