BLASTX nr result
ID: Forsythia23_contig00019056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00019056 (468 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094050.1| PREDICTED: uncharacterized protein LOC105173... 61 3e-07 >ref|XP_011094050.1| PREDICTED: uncharacterized protein LOC105173853 [Sesamum indicum] Length = 241 Score = 60.8 bits (146), Expect = 3e-07 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = -2 Query: 209 IFEEPDGVVGLGILAALSDRHQDPIFMNCS-RDAVLAISPKSLSNPTPIL 63 IFEEP+GVVGLGILAAL +QDP +++ R AVLAISPKS SNP PIL Sbjct: 35 IFEEPNGVVGLGILAAL--ENQDPDYVSGGVRSAVLAISPKSASNPIPIL 82