BLASTX nr result
ID: Forsythia23_contig00018927
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00018927 (474 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAH59413.1| auxin resistance protein [Plantago major] 115 1e-23 ref|XP_004495802.1| PREDICTED: auxin-responsive protein IAA16 [C... 113 6e-23 gb|AKJ80184.1| auxin-responsive protein IAA14-like protein, part... 112 1e-22 ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max] gi... 112 1e-22 gb|AFK44393.1| unknown [Lotus japonicus] 112 1e-22 gb|AFK37379.1| unknown [Medicago truncatula] 112 1e-22 ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medi... 112 1e-22 ref|XP_012490651.1| PREDICTED: auxin-induced protein AUX28-like ... 111 2e-22 ref|XP_010038039.1| PREDICTED: auxin-induced protein AUX28-like ... 111 2e-22 dbj|BAJ97201.1| predicted protein [Hordeum vulgare subsp. vulgare] 111 2e-22 ref|NP_187124.1| auxin-responsive protein IAA16 [Arabidopsis tha... 110 3e-22 ref|XP_010485858.1| PREDICTED: auxin-responsive protein IAA16-li... 110 3e-22 ref|XP_010418365.1| PREDICTED: auxin-responsive protein IAA16 [C... 110 3e-22 gb|KFK37887.1| hypothetical protein AALP_AA3G042100 [Arabis alpina] 110 3e-22 ref|XP_010024036.1| PREDICTED: auxin-responsive protein IAA14-li... 110 3e-22 ref|XP_007050421.1| Indole-3-acetic acid inducible 14 isoform 1 ... 110 3e-22 ref|XP_006298436.1| hypothetical protein CARUB_v10014507mg [Caps... 110 3e-22 gb|ADL70680.1| indole-3-acetic acid inducible 16 [Arabidopsis th... 110 3e-22 gb|ADL70673.1| indole-3-acetic acid inducible 16 [Arabidopsis th... 110 3e-22 gb|ADL70671.1| indole-3-acetic acid inducible 16 [Arabidopsis th... 110 3e-22 >emb|CAH59413.1| auxin resistance protein [Plantago major] Length = 227 Score = 115 bits (287), Expect = 1e-23 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 SD+VPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRA+EKCK RS Sbjct: 173 SDYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRAMEKCKSRS 227 >ref|XP_004495802.1| PREDICTED: auxin-responsive protein IAA16 [Cicer arietinum] Length = 252 Score = 113 bits (282), Expect = 6e-23 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 SD+VPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKG+EAIGLAPRA+EKCK RS Sbjct: 198 SDYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAVEKCKNRS 252 >gb|AKJ80184.1| auxin-responsive protein IAA14-like protein, partial [Lupinus albus] Length = 228 Score = 112 bits (279), Expect = 1e-22 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 S+FVPTYEDKDGDWML+GDVPWEMFVGSCKRLRIMKG+EAIGLAPRA+EKCK RS Sbjct: 174 SEFVPTYEDKDGDWMLLGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKRRS 228 >ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max] gi|238058427|gb|ACR39367.1| Aux/IAA protein [Glycine max] Length = 239 Score = 112 bits (279), Expect = 1e-22 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 S++VPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKG+EAIGLAPRA+EKCK RS Sbjct: 185 SEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKSRS 239 >gb|AFK44393.1| unknown [Lotus japonicus] Length = 242 Score = 112 bits (279), Expect = 1e-22 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 S++VPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKG+EAIGLAPRA+EKCK RS Sbjct: 188 SEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNRS 242 >gb|AFK37379.1| unknown [Medicago truncatula] Length = 236 Score = 112 bits (279), Expect = 1e-22 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 S++VPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKG+EAIGLAPRA+EKCK RS Sbjct: 182 SEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNRS 236 >ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medicago truncatula] gi|355480854|gb|AES62057.1| auxin-responsive AUX/IAA family protein [Medicago truncatula] Length = 236 Score = 112 bits (279), Expect = 1e-22 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 S++VPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKG+EAIGLAPRA+EKCK RS Sbjct: 182 SEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNRS 236 >ref|XP_012490651.1| PREDICTED: auxin-induced protein AUX28-like [Gossypium raimondii] gi|763775077|gb|KJB42200.1| hypothetical protein B456_007G141900 [Gossypium raimondii] Length = 235 Score = 111 bits (278), Expect = 2e-22 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 SD+VPTYEDKDGDWMLVGDVPWEMF+ SCKRLRIMKGTEAIGLAPRA+EKCK RS Sbjct: 181 SDYVPTYEDKDGDWMLVGDVPWEMFIESCKRLRIMKGTEAIGLAPRAMEKCKNRS 235 >ref|XP_010038039.1| PREDICTED: auxin-induced protein AUX28-like [Eucalyptus grandis] gi|629083393|gb|KCW49838.1| hypothetical protein EUGRSUZ_K03313 [Eucalyptus grandis] Length = 280 Score = 111 bits (278), Expect = 2e-22 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 SD+VPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGTEA+GLAPRA+EKCK RS Sbjct: 226 SDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAVGLAPRAMEKCKSRS 280 >dbj|BAJ97201.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 241 Score = 111 bits (277), Expect = 2e-22 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 SD+VPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKG+EAIGLAPRA+EKCK RS Sbjct: 187 SDYVPTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEKCKSRS 241 >ref|NP_187124.1| auxin-responsive protein IAA16 [Arabidopsis thaliana] gi|11131089|sp|O24407.1|IAA16_ARATH RecName: Full=Auxin-responsive protein IAA16; AltName: Full=Indoleacetic acid-induced protein 16 gi|6175173|gb|AAF04899.1|AC011437_14 auxin-induced protein [Arabidopsis thaliana] gi|12083210|gb|AAG48764.1|AF332400_1 auxin-induced protein IAA16 [Arabidopsis thaliana] gi|14030659|gb|AAK53004.1|AF375420_1 AT3g04730/F7O18_22 [Arabidopsis thaliana] gi|2618721|gb|AAB84353.1| IAA16 [Arabidopsis thaliana] gi|21592802|gb|AAM64751.1| auxin-induced protein [Arabidopsis thaliana] gi|23507781|gb|AAN38694.1| At3g04730/F7O18_22 [Arabidopsis thaliana] gi|110738766|dbj|BAF01307.1| auxin-induced protein [Arabidopsis thaliana] gi|332640606|gb|AEE74127.1| auxin-responsive protein IAA16 [Arabidopsis thaliana] Length = 236 Score = 110 bits (276), Expect = 3e-22 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 SD+VPTYEDKDGDWMLVGDVPWEMFV SCKR+RIMKG+EAIGLAPRALEKCK RS Sbjct: 182 SDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 236 >ref|XP_010485858.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa] Length = 232 Score = 110 bits (276), Expect = 3e-22 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 SD+VPTYEDKDGDWMLVGDVPWEMFV SCKR+RIMKG+EAIGLAPRALEKCK RS Sbjct: 178 SDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 232 >ref|XP_010418365.1| PREDICTED: auxin-responsive protein IAA16 [Camelina sativa] Length = 232 Score = 110 bits (276), Expect = 3e-22 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 SD+VPTYEDKDGDWMLVGDVPWEMFV SCKR+RIMKG+EAIGLAPRALEKCK RS Sbjct: 178 SDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 232 >gb|KFK37887.1| hypothetical protein AALP_AA3G042100 [Arabis alpina] Length = 232 Score = 110 bits (276), Expect = 3e-22 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 SD+VPTYEDKDGDWMLVGDVPWEMFV SCKR+RIMKG+EAIGLAPRALEKCK RS Sbjct: 178 SDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 232 >ref|XP_010024036.1| PREDICTED: auxin-responsive protein IAA14-like [Eucalyptus grandis] gi|629094455|gb|KCW60450.1| hypothetical protein EUGRSUZ_H03170 [Eucalyptus grandis] Length = 243 Score = 110 bits (276), Expect = 3e-22 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 SD+VPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKG+EAIGLAPRA+EKCK RS Sbjct: 189 SDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS 243 >ref|XP_007050421.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao] gi|508702682|gb|EOX94578.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao] Length = 305 Score = 110 bits (276), Expect = 3e-22 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 SD+VPTYEDKDGDWMLVGDVPW+MFV SCKRLRIMKGTEAIGLAPRA+EKCK RS Sbjct: 251 SDYVPTYEDKDGDWMLVGDVPWDMFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS 305 >ref|XP_006298436.1| hypothetical protein CARUB_v10014507mg [Capsella rubella] gi|482567145|gb|EOA31334.1| hypothetical protein CARUB_v10014507mg [Capsella rubella] Length = 241 Score = 110 bits (276), Expect = 3e-22 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 SD+VPTYEDKDGDWMLVGDVPWEMFV SCKR+RIMKG+EAIGLAPRALEKCK RS Sbjct: 187 SDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 241 >gb|ADL70680.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana] Length = 152 Score = 110 bits (276), Expect = 3e-22 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 SD+VPTYEDKDGDWMLVGDVPWEMFV SCKR+RIMKG+EAIGLAPRALEKCK RS Sbjct: 98 SDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 152 >gb|ADL70673.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana] gi|304322374|gb|ADL70674.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana] Length = 165 Score = 110 bits (276), Expect = 3e-22 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 SD+VPTYEDKDGDWMLVGDVPWEMFV SCKR+RIMKG+EAIGLAPRALEKCK RS Sbjct: 111 SDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 165 >gb|ADL70671.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana] Length = 167 Score = 110 bits (276), Expect = 3e-22 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +1 Query: 1 SDFVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRALEKCKYRS 165 SD+VPTYEDKDGDWMLVGDVPWEMFV SCKR+RIMKG+EAIGLAPRALEKCK RS Sbjct: 113 SDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 167