BLASTX nr result
ID: Forsythia23_contig00018754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00018754 (326 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076897.1| PREDICTED: NAC domain-containing protein 78-... 70 6e-10 emb|CDO99814.1| unnamed protein product [Coffea canephora] 58 2e-06 ref|XP_002315338.2| hypothetical protein POPTR_0010s23650g [Popu... 58 3e-06 ref|XP_006378789.1| NAC domain-containing protein 78 [Populus tr... 58 3e-06 ref|XP_012834786.1| PREDICTED: NAC domain-containing protein 53-... 57 6e-06 ref|XP_009764398.1| PREDICTED: NAC domain-containing protein 78-... 56 8e-06 >ref|XP_011076897.1| PREDICTED: NAC domain-containing protein 78-like [Sesamum indicum] Length = 563 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -2 Query: 325 SVLPGKTISATSRGWFDFIFFWVLILTMSFKIGTYICAR 209 S+LPGKT+S SRGWF FIFFWVLIL+MSFKIGT ICA+ Sbjct: 525 SILPGKTLSTLSRGWFCFIFFWVLILSMSFKIGTCICAK 563 >emb|CDO99814.1| unnamed protein product [Coffea canephora] Length = 582 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/40 (70%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = -2 Query: 325 SVLPGKTI-SATSRGWFDFIFFWVLILTMSFKIGTYICAR 209 S+ PGK S SRGWF FIFFWVLIL++ FKIGT ICAR Sbjct: 543 SIRPGKAAASGMSRGWFCFIFFWVLILSVGFKIGTCICAR 582 >ref|XP_002315338.2| hypothetical protein POPTR_0010s23650g [Populus trichocarpa] gi|550330459|gb|EEF01509.2| hypothetical protein POPTR_0010s23650g [Populus trichocarpa] Length = 556 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -2 Query: 325 SVLPGKTISATSRGWFDFIFFWVLILTMSFKIGTYICAR 209 S+ PGKT S SRGW +FFWVLIL++S+KIGT ICA+ Sbjct: 518 SLFPGKTESVVSRGWLYLMFFWVLILSVSYKIGTCICAK 556 >ref|XP_006378789.1| NAC domain-containing protein 78 [Populus trichocarpa] gi|550330458|gb|ERP56586.1| NAC domain-containing protein 78 [Populus trichocarpa] Length = 554 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -2 Query: 325 SVLPGKTISATSRGWFDFIFFWVLILTMSFKIGTYICAR 209 S+ PGKT S SRGW +FFWVLIL++S+KIGT ICA+ Sbjct: 516 SLFPGKTESVVSRGWLYLMFFWVLILSVSYKIGTCICAK 554 >ref|XP_012834786.1| PREDICTED: NAC domain-containing protein 53-like [Erythranthe guttatus] gi|604335783|gb|EYU39671.1| hypothetical protein MIMGU_mgv1a003896mg [Erythranthe guttata] Length = 557 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -2 Query: 325 SVLPGKTISATSRGWFDFIFFWVLILTMSFKIGTYICAR 209 S LPGK S SRGW F+F WVLIL++SFKIG ICA+ Sbjct: 519 SALPGKAASTVSRGWLYFMFLWVLILSVSFKIGICICAK 557 >ref|XP_009764398.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris] Length = 542 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 325 SVLPGKTISATSRGWFDFIFFWVLILTMSFKIGTYICA 212 S+LPGKTISA S WF ++F WVLIL+MSFKIGT I A Sbjct: 504 SILPGKTISAASWCWFYYLFSWVLILSMSFKIGTLIRA 541