BLASTX nr result
ID: Forsythia23_contig00018753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00018753 (414 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076897.1| PREDICTED: NAC domain-containing protein 78-... 71 3e-10 ref|XP_012834786.1| PREDICTED: NAC domain-containing protein 53-... 58 2e-06 ref|XP_002315338.2| hypothetical protein POPTR_0010s23650g [Popu... 57 4e-06 ref|XP_006378789.1| NAC domain-containing protein 78 [Populus tr... 57 4e-06 ref|XP_011101545.1| PREDICTED: NAC domain-containing protein 78-... 56 8e-06 ref|XP_011101544.1| PREDICTED: NAC domain-containing protein 78-... 56 8e-06 ref|XP_011101543.1| PREDICTED: NAC domain-containing protein 78-... 56 8e-06 >ref|XP_011076897.1| PREDICTED: NAC domain-containing protein 78-like [Sesamum indicum] Length = 563 Score = 70.9 bits (172), Expect = 3e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -2 Query: 413 SVLPGKTVSTTSRGWFDFIFFWVLILTMSFKIGTYICA 300 S+LPGKT+ST SRGWF FIFFWVLIL+MSFKIGT ICA Sbjct: 525 SILPGKTLSTLSRGWFCFIFFWVLILSMSFKIGTCICA 562 >ref|XP_012834786.1| PREDICTED: NAC domain-containing protein 53-like [Erythranthe guttatus] gi|604335783|gb|EYU39671.1| hypothetical protein MIMGU_mgv1a003896mg [Erythranthe guttata] Length = 557 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -2 Query: 413 SVLPGKTVSTTSRGWFDFIFFWVLILTMSFKIGTYICA 300 S LPGK ST SRGW F+F WVLIL++SFKIG ICA Sbjct: 519 SALPGKAASTVSRGWLYFMFLWVLILSVSFKIGICICA 556 >ref|XP_002315338.2| hypothetical protein POPTR_0010s23650g [Populus trichocarpa] gi|550330459|gb|EEF01509.2| hypothetical protein POPTR_0010s23650g [Populus trichocarpa] Length = 556 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -2 Query: 413 SVLPGKTVSTTSRGWFDFIFFWVLILTMSFKIGTYICA 300 S+ PGKT S SRGW +FFWVLIL++S+KIGT ICA Sbjct: 518 SLFPGKTESVVSRGWLYLMFFWVLILSVSYKIGTCICA 555 >ref|XP_006378789.1| NAC domain-containing protein 78 [Populus trichocarpa] gi|550330458|gb|ERP56586.1| NAC domain-containing protein 78 [Populus trichocarpa] Length = 554 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -2 Query: 413 SVLPGKTVSTTSRGWFDFIFFWVLILTMSFKIGTYICA 300 S+ PGKT S SRGW +FFWVLIL++S+KIGT ICA Sbjct: 516 SLFPGKTESVVSRGWLYLMFFWVLILSVSYKIGTCICA 553 >ref|XP_011101545.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Sesamum indicum] gi|747106507|ref|XP_011101546.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Sesamum indicum] Length = 459 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -2 Query: 410 VLPGKTVSTTSRGWFDFIFFWVLILTMSFKIGTY 309 +LPGK S+ S+GWF F+FFWVLIL++SFKI TY Sbjct: 424 ILPGKVASSISKGWFYFMFFWVLILSVSFKIATY 457 >ref|XP_011101544.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Sesamum indicum] Length = 542 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -2 Query: 410 VLPGKTVSTTSRGWFDFIFFWVLILTMSFKIGTY 309 +LPGK S+ S+GWF F+FFWVLIL++SFKI TY Sbjct: 507 ILPGKVASSISKGWFYFMFFWVLILSVSFKIATY 540 >ref|XP_011101543.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Sesamum indicum] Length = 547 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -2 Query: 410 VLPGKTVSTTSRGWFDFIFFWVLILTMSFKIGTY 309 +LPGK S+ S+GWF F+FFWVLIL++SFKI TY Sbjct: 512 ILPGKVASSISKGWFYFMFFWVLILSVSFKIATY 545