BLASTX nr result
ID: Forsythia23_contig00018397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00018397 (344 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012844314.1| PREDICTED: histone acetyltransferase MCC1 [E... 67 4e-09 ref|XP_011075780.1| PREDICTED: histone acetyltransferase MCC1 [S... 63 9e-08 >ref|XP_012844314.1| PREDICTED: histone acetyltransferase MCC1 [Erythranthe guttatus] gi|604347082|gb|EYU45386.1| hypothetical protein MIMGU_mgv1a012288mg [Erythranthe guttata] gi|604347083|gb|EYU45387.1| hypothetical protein MIMGU_mgv1a012288mg [Erythranthe guttata] Length = 255 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -2 Query: 343 LWKNEDKKISKWPTSKESGYLLPVVQNKRILTSEGTRCQYL 221 LW+NE++KISKWP KESG LLP VQNKR +T EG+RCQ++ Sbjct: 215 LWRNEERKISKWPKCKESGCLLPTVQNKRSVTGEGSRCQFV 255 >ref|XP_011075780.1| PREDICTED: histone acetyltransferase MCC1 [Sesamum indicum] Length = 255 Score = 62.8 bits (151), Expect = 9e-08 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -2 Query: 343 LWKNEDKKISKWPTSKESGYLLPVVQNKRILTSEGTRCQYL 221 LWKNE++KISKWP KESG LLP VQNKR+ T E +RC ++ Sbjct: 215 LWKNEERKISKWPKCKESGCLLPTVQNKRMSTGEVSRCTFV 255