BLASTX nr result
ID: Forsythia23_contig00018359
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00018359 (325 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080265.1| PREDICTED: zinc finger A20 and AN1 domain-co... 73 9e-11 ref|XP_009776796.1| PREDICTED: zinc finger A20 and AN1 domain-co... 73 9e-11 ref|XP_006361216.1| PREDICTED: zinc finger A20 and AN1 domain-co... 72 1e-10 ref|NP_001275387.1| zinc finger A20 and AN1 domain-containing st... 72 1e-10 ref|XP_004228358.1| PREDICTED: zinc finger A20 and AN1 domain-co... 70 4e-10 ref|XP_009593342.1| PREDICTED: zinc finger A20 and AN1 domain-co... 69 9e-10 ref|XP_011090378.1| PREDICTED: zinc finger A20 and AN1 domain-co... 69 1e-09 ref|XP_006354259.1| PREDICTED: zinc finger A20 and AN1 domain-co... 69 1e-09 gb|ACM68452.1| stress-associated protein 2 [Solanum pennellii] 69 1e-09 ref|XP_004250869.1| PREDICTED: zinc finger A20 and AN1 domain-co... 69 1e-09 gb|ACM68440.1| stress-associated protein 3 [Solanum lycopersicum] 67 5e-09 ref|XP_009770813.1| PREDICTED: zinc finger A20 and AN1 domain-co... 66 1e-08 ref|XP_009589284.1| PREDICTED: zinc finger A20 and AN1 domain-co... 66 1e-08 gb|KDO64800.1| hypothetical protein CISIN_1g030300mg [Citrus sin... 66 1e-08 ref|XP_012829782.1| PREDICTED: zinc finger A20 and AN1 domain-co... 66 1e-08 ref|XP_010031823.1| PREDICTED: zinc finger A20 and AN1 domain-co... 65 2e-08 ref|XP_010031824.1| PREDICTED: zinc finger A20 and AN1 domain-co... 65 2e-08 ref|XP_011037831.1| PREDICTED: zinc finger A20 and AN1 domain-co... 65 2e-08 ref|XP_010673602.1| PREDICTED: zinc finger A20 and AN1 domain-co... 65 2e-08 ref|XP_002297783.1| zinc finger family protein [Populus trichoca... 65 2e-08 >ref|XP_011080265.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Sesamum indicum] gi|747067126|ref|XP_011080266.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Sesamum indicum] Length = 172 Score = 72.8 bits (177), Expect = 9e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAAN 2 MEHDETGCQPPPEGPILCVNNCGFFGSAAN Sbjct: 1 MEHDETGCQPPPEGPILCVNNCGFFGSAAN 30 >ref|XP_009776796.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8 [Nicotiana sylvestris] gi|698578598|ref|XP_009776797.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8 [Nicotiana sylvestris] Length = 172 Score = 72.8 bits (177), Expect = 9e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAAN 2 MEHDETGCQPPPEGPILCVNNCGFFGSAAN Sbjct: 1 MEHDETGCQPPPEGPILCVNNCGFFGSAAN 30 >ref|XP_006361216.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like isoform X2 [Solanum tuberosum] Length = 171 Score = 72.4 bits (176), Expect = 1e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAAN 2 MEHDETGCQPPPEGPILC+NNCGFFGSAAN Sbjct: 1 MEHDETGCQPPPEGPILCINNCGFFGSAAN 30 >ref|NP_001275387.1| zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Solanum tuberosum] gi|413968556|gb|AFW90615.1| stress-associated protein 3 [Solanum tuberosum] gi|418730075|gb|AFX66985.1| stress-associated protein 3 [Solanum tuberosum] Length = 171 Score = 72.4 bits (176), Expect = 1e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAAN 2 MEHDETGCQPPPEGPILC+NNCGFFGSAAN Sbjct: 1 MEHDETGCQPPPEGPILCINNCGFFGSAAN 30 >ref|XP_004228358.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Solanum lycopersicum] gi|460364928|ref|XP_004228359.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Solanum lycopersicum] Length = 171 Score = 70.5 bits (171), Expect = 4e-10 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAAN 2 MEH+ETGCQPPPEGPILC+NNCGFFGSAAN Sbjct: 1 MEHNETGCQPPPEGPILCINNCGFFGSAAN 30 >ref|XP_009593342.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8 [Nicotiana tomentosiformis] gi|697168897|ref|XP_009593343.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8 [Nicotiana tomentosiformis] gi|697168899|ref|XP_009593344.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8 [Nicotiana tomentosiformis] Length = 172 Score = 69.3 bits (168), Expect = 9e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAAN 2 MEHDETGCQP PEGPILCVNNCGFFGSAAN Sbjct: 1 MEHDETGCQPHPEGPILCVNNCGFFGSAAN 30 >ref|XP_011090378.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Sesamum indicum] gi|747085806|ref|XP_011090379.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Sesamum indicum] Length = 167 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAAN 2 MEHDETGCQP PEGP+LCVNNCGFFGSAAN Sbjct: 1 MEHDETGCQPHPEGPVLCVNNCGFFGSAAN 30 >ref|XP_006354259.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Solanum tuberosum] Length = 170 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAAN 2 MEHDETGCQP PEGPILC+NNCGFFGSAAN Sbjct: 1 MEHDETGCQPHPEGPILCINNCGFFGSAAN 30 >gb|ACM68452.1| stress-associated protein 2 [Solanum pennellii] Length = 170 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAAN 2 MEHDETGCQP PEGPILC+NNCGFFGSAAN Sbjct: 1 MEHDETGCQPHPEGPILCINNCGFFGSAAN 30 >ref|XP_004250869.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Solanum lycopersicum] gi|222822653|gb|ACM68439.1| stress-associated protein 2 [Solanum lycopersicum] Length = 170 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAAN 2 MEHDETGCQP PEGPILC+NNCGFFGSAAN Sbjct: 1 MEHDETGCQPHPEGPILCINNCGFFGSAAN 30 >gb|ACM68440.1| stress-associated protein 3 [Solanum lycopersicum] Length = 171 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAAN 2 MEH+ETGCQPP EGPILC+NNCGFFGSAAN Sbjct: 1 MEHNETGCQPPREGPILCINNCGFFGSAAN 30 >ref|XP_009770813.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Nicotiana sylvestris] Length = 172 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAAN 2 MEHDETGCQ PEGPILC+NNCGFFGSAAN Sbjct: 1 MEHDETGCQSHPEGPILCINNCGFFGSAAN 30 >ref|XP_009589284.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Nicotiana tomentosiformis] gi|697161012|ref|XP_009589285.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Nicotiana tomentosiformis] Length = 172 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAAN 2 MEHDETGCQ PEGPILC+NNCGFFGSAAN Sbjct: 1 MEHDETGCQSHPEGPILCINNCGFFGSAAN 30 >gb|KDO64800.1| hypothetical protein CISIN_1g030300mg [Citrus sinensis] Length = 179 Score = 65.9 bits (159), Expect = 1e-08 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 103 GSYGMEHDETGCQPPPEGPILCVNNCGFFGSAA 5 G M+HDETGCQ PPEGPILC+NNCGFFGS A Sbjct: 4 GGENMDHDETGCQAPPEGPILCINNCGFFGSVA 36 >ref|XP_012829782.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Erythranthe guttatus] gi|604348127|gb|EYU46282.1| hypothetical protein MIMGU_mgv1a014897mg [Erythranthe guttata] gi|604348128|gb|EYU46283.1| hypothetical protein MIMGU_mgv1a014897mg [Erythranthe guttata] Length = 174 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAAN 2 MEHDETGCQ PEGP+LCVNNCGFFGSAAN Sbjct: 1 MEHDETGCQASPEGPLLCVNNCGFFGSAAN 30 >ref|XP_010031823.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8 isoform X1 [Eucalyptus grandis] Length = 196 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAA 5 MEHDETGCQ PPEGPILC+NNCGFFGS A Sbjct: 26 MEHDETGCQAPPEGPILCINNCGFFGSPA 54 >ref|XP_010031824.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8 isoform X2 [Eucalyptus grandis] gi|702475483|ref|XP_010031825.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8 isoform X2 [Eucalyptus grandis] gi|629084848|gb|KCW51205.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis] gi|629084849|gb|KCW51206.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis] gi|629084850|gb|KCW51207.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis] gi|629084851|gb|KCW51208.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis] gi|629084852|gb|KCW51209.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis] Length = 171 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAA 5 MEHDETGCQ PPEGPILC+NNCGFFGS A Sbjct: 1 MEHDETGCQAPPEGPILCINNCGFFGSPA 29 >ref|XP_011037831.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Populus euphratica] gi|743886381|ref|XP_011037832.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Populus euphratica] Length = 172 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAA 5 M+HDETGCQ PPEGPILC NNCGFFGSAA Sbjct: 1 MDHDETGCQAPPEGPILCTNNCGFFGSAA 29 >ref|XP_010673602.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8 [Beta vulgaris subsp. vulgaris] gi|870863292|gb|KMT14456.1| hypothetical protein BVRB_4g072320 [Beta vulgaris subsp. vulgaris] Length = 174 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAA 5 M+HDETGCQ PPEGPILCVNNCGFFGS A Sbjct: 1 MDHDETGCQAPPEGPILCVNNCGFFGSVA 29 >ref|XP_002297783.1| zinc finger family protein [Populus trichocarpa] gi|118481683|gb|ABK92782.1| unknown [Populus trichocarpa] gi|222845041|gb|EEE82588.1| zinc finger family protein [Populus trichocarpa] Length = 172 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 91 MEHDETGCQPPPEGPILCVNNCGFFGSAA 5 M+HDETGCQ PPEGPILC NNCGFFGSAA Sbjct: 1 MDHDETGCQAPPEGPILCTNNCGFFGSAA 29