BLASTX nr result
ID: Forsythia23_contig00018342
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00018342 (452 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26357.3| unnamed protein product [Vitis vinifera] 75 2e-11 ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14 [V... 75 2e-11 ref|XP_011073485.1| PREDICTED: auxin-responsive protein IAA14 [S... 73 8e-11 emb|CDO99148.1| unnamed protein product [Coffea canephora] 73 8e-11 ref|XP_007205640.1| hypothetical protein PRUPE_ppa009254mg [Prun... 73 8e-11 gb|ADJ68049.1| auxin responsive protein [Catharanthus roseus] 73 8e-11 ref|XP_010550916.1| PREDICTED: LOW QUALITY PROTEIN: auxin-respon... 72 1e-10 ref|XP_010102292.1| Auxin-responsive protein IAA16 [Morus notabi... 72 1e-10 ref|XP_012462702.1| PREDICTED: auxin-responsive protein IAA16 [G... 72 1e-10 ref|XP_011038568.1| PREDICTED: auxin-responsive protein IAA16-li... 72 1e-10 ref|XP_010274203.1| PREDICTED: auxin-responsive protein IAA16-li... 72 1e-10 ref|XP_009761467.1| PREDICTED: auxin-responsive protein IAA16 [N... 72 1e-10 ref|XP_009610435.1| PREDICTED: auxin-responsive protein IAA16 [N... 72 1e-10 ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Popu... 72 1e-10 gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tab... 72 1e-10 gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana ta... 72 1e-10 ref|XP_012842823.1| PREDICTED: auxin-responsive protein IAA14-li... 72 1e-10 ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobr... 72 1e-10 gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum] 72 1e-10 ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum] gi|36581... 72 1e-10 >emb|CBI26357.3| unnamed protein product [Vitis vinifera] Length = 237 Score = 74.7 bits (182), Expect = 2e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNRC 108 VPWEMFVD+CKRLRIMKGSEAIGLAPR +E+CKNRC Sbjct: 202 VPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRC 237 >ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14 [Vitis vinifera] Length = 243 Score = 74.7 bits (182), Expect = 2e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNRC 108 VPWEMFVD+CKRLRIMKGSEAIGLAPR +E+CKNRC Sbjct: 208 VPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRC 243 >ref|XP_011073485.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum] Length = 251 Score = 72.8 bits (177), Expect = 8e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNRC 108 VPWEMFVD+CKRLRIMKGSEAIGLAPR +E+CK+RC Sbjct: 216 VPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRC 251 >emb|CDO99148.1| unnamed protein product [Coffea canephora] Length = 239 Score = 72.8 bits (177), Expect = 8e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNRC 108 VPWEMFVD+CKRLRIMKGSEAIGLAPR +E+CK+RC Sbjct: 204 VPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRC 239 >ref|XP_007205640.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica] gi|462401282|gb|EMJ06839.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica] Length = 299 Score = 72.8 bits (177), Expect = 8e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNRC 108 VPW MFVD+CKRLRIMKGSEAIGLAPR +E+CKNRC Sbjct: 264 VPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC 299 >gb|ADJ68049.1| auxin responsive protein [Catharanthus roseus] Length = 242 Score = 72.8 bits (177), Expect = 8e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNRC 108 VPWEMFVD+CKRLRIMKGSEAIGLAPR +E+CK+RC Sbjct: 207 VPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRC 242 >ref|XP_010550916.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA16 [Tarenaya hassleriana] Length = 212 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNRC 108 VPWEMFVD+CKRLRIMKGSEAIGLAPR + +CKNRC Sbjct: 177 VPWEMFVDSCKRLRIMKGSEAIGLAPRALVKCKNRC 212 >ref|XP_010102292.1| Auxin-responsive protein IAA16 [Morus notabilis] gi|587905039|gb|EXB93235.1| Auxin-responsive protein IAA16 [Morus notabilis] Length = 257 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNR 105 VPWEMFVD+CKRLRIMKGSEAIGLAPR +E+CKNR Sbjct: 222 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 256 >ref|XP_012462702.1| PREDICTED: auxin-responsive protein IAA16 [Gossypium raimondii] gi|763815673|gb|KJB82525.1| hypothetical protein B456_013G200700 [Gossypium raimondii] Length = 246 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNR 105 VPWEMFVD+CKRLRIMKGSEAIGLAPR +E+CKNR Sbjct: 211 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 245 >ref|XP_011038568.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica] Length = 246 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNR 105 VPWEMFVD+CKRLRIMKGSEAIGLAPR +E+CKNR Sbjct: 211 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 245 >ref|XP_010274203.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera] Length = 252 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNR 105 VPWEMFVD+CKRLRIMKGSEAIGLAPR +E+CKNR Sbjct: 217 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 251 >ref|XP_009761467.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana sylvestris] Length = 240 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNR 105 VPWEMFVD+CKRLRIMKGSEAIGLAPR +E+CKNR Sbjct: 205 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 239 >ref|XP_009610435.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana tomentosiformis] Length = 240 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNR 105 VPWEMFVD+CKRLRIMKGSEAIGLAPR +E+CKNR Sbjct: 205 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 239 >ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa] gi|222857451|gb|EEE94998.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa] Length = 246 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNR 105 VPWEMFVD+CKRLRIMKGSEAIGLAPR +E+CKNR Sbjct: 211 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 245 >gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum] Length = 240 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNR 105 VPWEMFVD+CKRLRIMKGSEAIGLAPR +E+CKNR Sbjct: 205 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 239 >gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana tabacum] Length = 220 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNR 105 VPWEMFVD+CKRLRIMKGSEAIGLAPR +E+CKNR Sbjct: 185 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 219 >ref|XP_012842823.1| PREDICTED: auxin-responsive protein IAA14-like [Erythranthe guttatus] gi|604322128|gb|EYU32514.1| hypothetical protein MIMGU_mgv1a012542mg [Erythranthe guttata] Length = 247 Score = 72.0 bits (175), Expect = 1e-10 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNRC 108 VPWEMFVD+CKR+RIMKGSEAIGLAPR +E+CK+RC Sbjct: 212 VPWEMFVDSCKRIRIMKGSEAIGLAPRAMEKCKSRC 247 >ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobroma cacao] gi|508719172|gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao] Length = 249 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNR 105 VPWEMFVD+CKRLRIMKGSEAIGLAPR +E+CKNR Sbjct: 214 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 248 >gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum] Length = 246 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNR 105 VPWEMFVD+CKRLRIMKGSEAIGLAPR +E+CKNR Sbjct: 211 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 245 >ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum] gi|365818541|gb|AEX00359.1| IAA16 [Solanum lycopersicum] Length = 251 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 VPWEMFVDACKRLRIMKGSEAIGLAPRTIERCKNR 105 VPWEMFVD+CKRLRIMKGSEAIGLAPR +E+CKNR Sbjct: 216 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 250