BLASTX nr result
ID: Forsythia23_contig00017711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00017711 (573 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009623179.1| PREDICTED: NADP-dependent alkenal double bon... 65 2e-08 ref|XP_011093562.1| PREDICTED: 2-alkenal reductase (NADP(+)-depe... 65 2e-08 emb|CDP09536.1| unnamed protein product [Coffea canephora] 64 4e-08 emb|CDP09537.1| unnamed protein product [Coffea canephora] 64 5e-08 ref|XP_010914867.1| PREDICTED: 2-alkenal reductase (NADP(+)-depe... 63 8e-08 ref|XP_010914866.1| PREDICTED: 2-alkenal reductase (NADP(+)-depe... 63 8e-08 ref|XP_002285167.2| PREDICTED: 2-alkenal reductase (NADP(+)-depe... 63 1e-07 ref|XP_009797470.1| PREDICTED: NADP-dependent alkenal double bon... 63 1e-07 ref|XP_008242765.1| PREDICTED: 2-alkenal reductase (NADP(+)-depe... 63 1e-07 emb|CBI28191.3| unnamed protein product [Vitis vinifera] 63 1e-07 ref|XP_009623177.1| PREDICTED: NADP-dependent alkenal double bon... 62 2e-07 ref|XP_002265626.1| PREDICTED: 2-alkenal reductase (NADP(+)-depe... 62 2e-07 ref|XP_007138309.1| hypothetical protein PHAVU_009G197800g [Phas... 62 2e-07 ref|XP_002308086.2| hypothetical protein POPTR_0006s06930g [Popu... 61 4e-07 ref|XP_011020111.1| PREDICTED: 2-alkenal reductase (NADP(+)-depe... 60 5e-07 ref|XP_004247843.1| PREDICTED: NADP-dependent alkenal double bon... 60 5e-07 ref|XP_008792045.1| PREDICTED: 2-alkenal reductase (NADP(+)-depe... 60 7e-07 ref|XP_008792044.1| PREDICTED: 2-alkenal reductase (NADP(+)-depe... 60 7e-07 ref|XP_006360352.1| PREDICTED: NADP-dependent alkenal double bon... 60 7e-07 ref|XP_002308087.1| hypothetical protein POPTR_0006s06940g [Popu... 59 2e-06 >ref|XP_009623179.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like [Nicotiana tomentosiformis] gi|697138203|ref|XP_009623180.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like [Nicotiana tomentosiformis] gi|697138205|ref|XP_009623181.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like [Nicotiana tomentosiformis] Length = 346 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIADE 460 K+KA+ D+S G+ES+PSAFIGLFRGDN+GKKIV++ADE Sbjct: 309 KLKAIEDVSQGVESIPSAFIGLFRGDNIGKKIVKVADE 346 >ref|XP_011093562.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Sesamum indicum] Length = 345 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIADE 460 KM+AL DIS+G+ESVP AF+GLFRGDN+GK IVQIADE Sbjct: 308 KMQALCDISHGVESVPCAFVGLFRGDNIGKTIVQIADE 345 >emb|CDP09536.1| unnamed protein product [Coffea canephora] Length = 346 Score = 64.3 bits (155), Expect = 4e-08 Identities = 27/38 (71%), Positives = 36/38 (94%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIADE 460 K++ L DIS+GLES+PSAF+GLFRGDN+GKK+VQ+AD+ Sbjct: 309 KLQVLEDISHGLESIPSAFVGLFRGDNIGKKMVQLADD 346 >emb|CDP09537.1| unnamed protein product [Coffea canephora] Length = 346 Score = 63.9 bits (154), Expect = 5e-08 Identities = 27/38 (71%), Positives = 36/38 (94%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIADE 460 K++ L DIS+GLES+PSAF+GLFRGDN+GKK+VQ+AD+ Sbjct: 309 KLQVLEDISHGLESIPSAFVGLFRGDNMGKKMVQVADD 346 >ref|XP_010914867.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform X2 [Elaeis guineensis] Length = 342 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIAD 463 +M++L D+S+GLESVPSAF GLFRGDNVGKK+VQ+AD Sbjct: 305 RMQSLEDVSHGLESVPSAFAGLFRGDNVGKKLVQLAD 341 >ref|XP_010914866.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform X1 [Elaeis guineensis] Length = 347 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIAD 463 +M++L D+S+GLESVPSAF GLFRGDNVGKK+VQ+AD Sbjct: 310 RMQSLEDVSHGLESVPSAFAGLFRGDNVGKKLVQLAD 346 >ref|XP_002285167.2| PREDICTED: 2-alkenal reductase (NADP(+)-dependent) [Vitis vinifera] Length = 348 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIADE 460 K++ + DIS G+ES+PSAF+GLFRGDNVGKKIV+IADE Sbjct: 311 KIQVIEDISQGVESIPSAFVGLFRGDNVGKKIVKIADE 348 >ref|XP_009797470.1| PREDICTED: NADP-dependent alkenal double bond reductase P1-like [Nicotiana sylvestris] Length = 346 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIADE 460 K+KA+ D+S G+ES+PSAFIGLF GDN+GKKIV+IADE Sbjct: 309 KLKAIEDVSQGVESIPSAFIGLFCGDNIGKKIVKIADE 346 >ref|XP_008242765.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Prunus mume] Length = 346 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIADE 460 K+ A+ DIS+GLESVPSAFIGLFRG N GKKIV+IADE Sbjct: 309 KLHAIEDISHGLESVPSAFIGLFRGHNTGKKIVKIADE 346 >emb|CBI28191.3| unnamed protein product [Vitis vinifera] Length = 346 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIADE 460 K++ + DIS G+ES+PSAF+GLFRGDNVGKKIV+IADE Sbjct: 309 KIQVIEDISQGVESIPSAFVGLFRGDNVGKKIVKIADE 346 >ref|XP_009623177.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like isoform X1 [Nicotiana tomentosiformis] gi|697138199|ref|XP_009623178.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like isoform X2 [Nicotiana tomentosiformis] Length = 346 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIADE 460 K+KA+ D+S G+ES+PSAFIGLFRGDN+GKKIV++A E Sbjct: 309 KLKAIEDVSQGVESIPSAFIGLFRGDNIGKKIVKVAYE 346 >ref|XP_002265626.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent) [Vitis vinifera] gi|297735440|emb|CBI17880.3| unnamed protein product [Vitis vinifera] Length = 347 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIADE 460 K+ L DIS G+ES+PSAF+GLFRGDNVGKK+V++ADE Sbjct: 310 KIHVLEDISQGVESIPSAFVGLFRGDNVGKKVVKVADE 347 >ref|XP_007138309.1| hypothetical protein PHAVU_009G197800g [Phaseolus vulgaris] gi|561011396|gb|ESW10303.1| hypothetical protein PHAVU_009G197800g [Phaseolus vulgaris] Length = 371 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIADE 460 K+K L DIS G+ES+PSAF+GLFRGDN+GKKI+ +A+E Sbjct: 333 KLKVLEDISSGVESIPSAFVGLFRGDNIGKKIINLAEE 370 >ref|XP_002308086.2| hypothetical protein POPTR_0006s06930g [Populus trichocarpa] gi|550335668|gb|EEE91609.2| hypothetical protein POPTR_0006s06930g [Populus trichocarpa] Length = 347 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIADE 460 K+K DIS G+ES+P AFIGLFRGDNVGKKIV+IADE Sbjct: 310 KIKVQEDISIGVESIPLAFIGLFRGDNVGKKIVKIADE 347 >ref|XP_011020111.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Populus euphratica] Length = 346 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIADE 460 K+K DIS G+ES+P AFIGLFRGDNVGKKIV+IADE Sbjct: 309 KIKVQEDISNGVESIPLAFIGLFRGDNVGKKIVKIADE 346 >ref|XP_004247843.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like [Solanum lycopersicum] Length = 347 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIADE 460 K+K + DIS G+ES+PSAFIGLF G+N+GKKIV++ADE Sbjct: 310 KLKTVEDISQGVESIPSAFIGLFNGENIGKKIVKVADE 347 >ref|XP_008792045.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform X2 [Phoenix dactylifera] Length = 345 Score = 60.1 bits (144), Expect = 7e-07 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIA 466 +M++L DIS GLESVPSAF GLFRGDNVGKK+VQ+A Sbjct: 308 RMQSLEDISQGLESVPSAFAGLFRGDNVGKKLVQLA 343 >ref|XP_008792044.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform X1 [Phoenix dactylifera] Length = 398 Score = 60.1 bits (144), Expect = 7e-07 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIA 466 +M++L DIS GLESVPSAF GLFRGDNVGKK+VQ+A Sbjct: 361 RMQSLEDISQGLESVPSAFAGLFRGDNVGKKLVQLA 396 >ref|XP_006360352.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like [Solanum tuberosum] Length = 349 Score = 60.1 bits (144), Expect = 7e-07 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIADE 460 K+K + D+S G+ES+PSAFIGLF G+N+GKKIV++ADE Sbjct: 312 KLKTIEDVSRGVESIPSAFIGLFNGENIGKKIVKVADE 349 >ref|XP_002308087.1| hypothetical protein POPTR_0006s06940g [Populus trichocarpa] gi|222854063|gb|EEE91610.1| hypothetical protein POPTR_0006s06940g [Populus trichocarpa] Length = 219 Score = 58.9 bits (141), Expect = 2e-06 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -1 Query: 573 KMKALTDISYGLESVPSAFIGLFRGDNVGKKIVQIADE 460 K+K L DIS GLE++PSAF GLF G NVGKKIV+IADE Sbjct: 182 KIKVLEDISVGLETIPSAFTGLFHGHNVGKKIVRIADE 219