BLASTX nr result
ID: Forsythia23_contig00017515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00017515 (304 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012831622.1| PREDICTED: putative uridine kinase C227.14 i... 58 3e-06 ref|XP_012831614.1| PREDICTED: putative uridine kinase C227.14 i... 58 3e-06 >ref|XP_012831622.1| PREDICTED: putative uridine kinase C227.14 isoform X2 [Erythranthe guttatus] gi|604348354|gb|EYU46509.1| hypothetical protein MIMGU_mgv1a010459mg [Erythranthe guttata] Length = 310 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -3 Query: 152 KRTCFQKWNQVLFLPTNRALRLIAGQPGILTRKQNRLQVVRCHLKEIPII 3 +++ F WNQV PT +ALR + G+ G LT KQN QV++C LKE+PII Sbjct: 24 RKSWFPHWNQVHLFPTKKALRPLVGRTGNLTWKQNHSQVLKCQLKEVPII 73 >ref|XP_012831614.1| PREDICTED: putative uridine kinase C227.14 isoform X1 [Erythranthe guttatus] gi|604348353|gb|EYU46508.1| hypothetical protein MIMGU_mgv1a010459mg [Erythranthe guttata] Length = 311 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -3 Query: 152 KRTCFQKWNQVLFLPTNRALRLIAGQPGILTRKQNRLQVVRCHLKEIPII 3 +++ F WNQV PT +ALR + G+ G LT KQN QV++C LKE+PII Sbjct: 25 RKSWFPHWNQVHLFPTKKALRPLVGRTGNLTWKQNHSQVLKCQLKEVPII 74