BLASTX nr result
ID: Forsythia23_contig00017029
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00017029 (506 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02780.1| unnamed protein product [Coffea canephora] 61 5e-08 ref|XP_012854803.1| PREDICTED: probable dolichyl pyrophosphate M... 59 4e-07 ref|XP_002516724.1| dolichyl glycosyltransferase, putative [Rici... 57 9e-07 ref|XP_012854810.1| PREDICTED: probable dolichyl pyrophosphate M... 59 1e-06 >emb|CDP02780.1| unnamed protein product [Coffea canephora] Length = 517 Score = 61.2 bits (147), Expect(2) = 5e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 111 SAYYSEKPIGEKSSMAQHIAVILLNTCLILIDHGHFQ 1 + YYS KPI EK+S+A HIA+ILLN CLILIDHGHFQ Sbjct: 161 NVYYSGKPIKEKTSVAWHIALILLNPCLILIDHGHFQ 197 Score = 22.3 bits (46), Expect(2) = 5e-08 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 146 ILSPDLLIFFPTV 108 +LS D LIFFP V Sbjct: 144 VLSSDALIFFPAV 156 >ref|XP_012854803.1| PREDICTED: probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase isoform X1 [Erythranthe guttatus] gi|604346145|gb|EYU44642.1| hypothetical protein MIMGU_mgv1a004432mg [Erythranthe guttata] Length = 527 Score = 58.9 bits (141), Expect(2) = 4e-07 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -3 Query: 111 SAYYSEKPIGEKSSMAQHIAVILLNTCLILIDHGHFQ 1 + YYS KP G++SSMA H +ILLN CLILIDHGHFQ Sbjct: 170 TVYYSGKPTGDRSSMAWHTIMILLNPCLILIDHGHFQ 206 Score = 21.6 bits (44), Expect(2) = 4e-07 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 146 ILSPDLLIFFPTV 108 +L DL+IFFP V Sbjct: 153 VLMSDLMIFFPAV 165 >ref|XP_002516724.1| dolichyl glycosyltransferase, putative [Ricinus communis] gi|223544097|gb|EEF45622.1| dolichyl glycosyltransferase, putative [Ricinus communis] Length = 241 Score = 57.0 bits (136), Expect(2) = 9e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -3 Query: 105 YYSEKPIGEKSSMAQHIAVILLNTCLILIDHGHFQ 1 YY + IG KS +A HIAVIL+N CLILIDHGHFQ Sbjct: 160 YYGNRAIGHKSDVAWHIAVILINPCLILIDHGHFQ 194 Score = 22.3 bits (46), Expect(2) = 9e-07 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 146 ILSPDLLIFFPTV 108 +LS D LIFFP V Sbjct: 141 VLSSDALIFFPAV 153 >ref|XP_012854810.1| PREDICTED: probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase isoform X2 [Erythranthe guttatus] Length = 513 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -3 Query: 111 SAYYSEKPIGEKSSMAQHIAVILLNTCLILIDHGHFQ 1 + YYS KP G++SSMA H +ILLN CLILIDHGHFQ Sbjct: 156 TVYYSGKPTGDRSSMAWHTIMILLNPCLILIDHGHFQ 192