BLASTX nr result
ID: Forsythia23_contig00017015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00017015 (309 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006466604.1| PREDICTED: CLK4-associating serine/arginine ... 59 1e-06 ref|XP_006466602.1| PREDICTED: CLK4-associating serine/arginine ... 59 1e-06 gb|KDO79219.1| hypothetical protein CISIN_1g015425mg [Citrus sin... 58 2e-06 >ref|XP_006466604.1| PREDICTED: CLK4-associating serine/arginine rich protein-like isoform X3 [Citrus sinensis] Length = 504 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/42 (69%), Positives = 31/42 (73%) Frame = -2 Query: 305 ADALNRSEHSTFNSCKDRLDSLYSAAANRPFCYLSQTFVV*N 180 AD LNRSEH TFNSCKDRLDSL + PFC L QTF+V N Sbjct: 368 ADLLNRSEHWTFNSCKDRLDSLILCCSLPPFCCLRQTFLVLN 409 >ref|XP_006466602.1| PREDICTED: CLK4-associating serine/arginine rich protein-like isoform X1 [Citrus sinensis] Length = 595 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/42 (69%), Positives = 31/42 (73%) Frame = -2 Query: 305 ADALNRSEHSTFNSCKDRLDSLYSAAANRPFCYLSQTFVV*N 180 AD LNRSEH TFNSCKDRLDSL + PFC L QTF+V N Sbjct: 368 ADLLNRSEHWTFNSCKDRLDSLILCCSLPPFCCLRQTFLVLN 409 >gb|KDO79219.1| hypothetical protein CISIN_1g015425mg [Citrus sinensis] Length = 407 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = -2 Query: 305 ADALNRSEHSTFNSCKDRLDSLYSAAANRPFCYLSQTFVV 186 AD LNRSEH TFNSCKDRLDSL + PFC L QTF+V Sbjct: 368 ADLLNRSEHWTFNSCKDRLDSLILCCSLPPFCCLRQTFLV 407