BLASTX nr result
ID: Forsythia23_contig00016727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00016727 (409 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011091341.1| PREDICTED: 29 kDa ribonucleoprotein A, chlor... 57 4e-06 >ref|XP_011091341.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Sesamum indicum] Length = 283 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 227 QSVKCLTSKGWPCDHLVKVSSHKILQPASISHSLWIELNPI-GAICGKSRVPRLTAS 60 +S KC++SK WP DHL+K+S + LQ A +SHSL E NPI + C R+ R++A+ Sbjct: 16 KSFKCVSSKNWPSDHLLKISCPRTLQSAPVSHSLVFEFNPITSSACKSWRLSRVSAA 72