BLASTX nr result
ID: Forsythia23_contig00015981
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00015981 (335 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010097202.1| hypothetical protein L484_025749 [Morus nota... 64 4e-08 ref|XP_011073411.1| PREDICTED: signal recognition particle 54 kD... 64 4e-08 gb|KHN44189.1| Signal recognition particle 54 kDa protein 2 [Gly... 64 4e-08 gb|KHN22433.1| Signal recognition particle 54 kDa protein 2 [Gly... 64 4e-08 ref|XP_002517663.1| signal recognition particle 54 kD protein, p... 64 4e-08 ref|NP_001234428.1| signal recognition particle 54 kDa protein 2... 64 4e-08 ref|XP_006346598.1| PREDICTED: signal recognition particle 54 kD... 64 4e-08 ref|XP_007150766.1| hypothetical protein PHAVU_005G179000g [Phas... 64 4e-08 ref|XP_002299799.2| Signal recognition particle 54 kDa protein 1... 64 4e-08 ref|XP_002322968.2| Signal recognition particle 54 kDa protein 1... 64 4e-08 ref|XP_006373975.1| hypothetical protein POPTR_0016s12030g [Popu... 64 4e-08 gb|AGV54516.1| signal recognition particle 54 kDa protein 2 [Pha... 64 4e-08 ref|XP_007023271.1| Signal recognition particle, SRP54 subunit p... 64 4e-08 ref|XP_003545781.1| PREDICTED: signal recognition particle 54 kD... 64 4e-08 ref|XP_003543686.1| PREDICTED: signal recognition particle 54 kD... 64 4e-08 gb|ABK95819.1| unknown [Populus trichocarpa] 64 4e-08 ref|XP_010279659.1| PREDICTED: signal recognition particle 54 kD... 63 9e-08 ref|XP_010259930.1| PREDICTED: signal recognition particle 54 kD... 63 9e-08 gb|KJB70637.1| hypothetical protein B456_011G084700 [Gossypium r... 62 1e-07 ref|XP_012455795.1| PREDICTED: signal recognition particle 54 kD... 62 1e-07 >ref|XP_010097202.1| hypothetical protein L484_025749 [Morus notabilis] gi|587878262|gb|EXB67269.1| hypothetical protein L484_025749 [Morus notabilis] Length = 80 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA Sbjct: 39 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 68 >ref|XP_011073411.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Sesamum indicum] Length = 495 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA Sbjct: 454 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 483 >gb|KHN44189.1| Signal recognition particle 54 kDa protein 2 [Glycine soja] Length = 500 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA Sbjct: 454 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 483 >gb|KHN22433.1| Signal recognition particle 54 kDa protein 2 [Glycine soja] Length = 500 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA Sbjct: 454 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 483 >ref|XP_002517663.1| signal recognition particle 54 kD protein, putative [Ricinus communis] gi|223543295|gb|EEF44827.1| signal recognition particle 54 kD protein, putative [Ricinus communis] Length = 497 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA Sbjct: 454 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 483 >ref|NP_001234428.1| signal recognition particle 54 kDa protein 2 [Solanum lycopersicum] gi|1711512|sp|P49972.1|SR542_SOLLC RecName: Full=Signal recognition particle 54 kDa protein 2; Short=SRP54 gi|556902|emb|CAA84288.1| 54-kD signal recognition particle (SRP) specific protein [Solanum lycopersicum] Length = 499 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA Sbjct: 454 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 483 >ref|XP_006346598.1| PREDICTED: signal recognition particle 54 kDa protein 2-like [Solanum tuberosum] Length = 499 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA Sbjct: 454 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 483 >ref|XP_007150766.1| hypothetical protein PHAVU_005G179000g [Phaseolus vulgaris] gi|561024030|gb|ESW22760.1| hypothetical protein PHAVU_005G179000g [Phaseolus vulgaris] Length = 498 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA Sbjct: 454 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 483 >ref|XP_002299799.2| Signal recognition particle 54 kDa protein 1 [Populus trichocarpa] gi|550348208|gb|EEE84604.2| Signal recognition particle 54 kDa protein 1 [Populus trichocarpa] Length = 495 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA Sbjct: 454 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 483 >ref|XP_002322968.2| Signal recognition particle 54 kDa protein 1 [Populus trichocarpa] gi|550321316|gb|EEF04729.2| Signal recognition particle 54 kDa protein 1 [Populus trichocarpa] Length = 493 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA Sbjct: 452 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 481 >ref|XP_006373975.1| hypothetical protein POPTR_0016s12030g [Populus trichocarpa] gi|743907960|ref|XP_011047423.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Populus euphratica] gi|550321315|gb|ERP51772.1| hypothetical protein POPTR_0016s12030g [Populus trichocarpa] Length = 495 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA Sbjct: 454 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 483 >gb|AGV54516.1| signal recognition particle 54 kDa protein 2 [Phaseolus vulgaris] Length = 496 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA Sbjct: 452 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 481 >ref|XP_007023271.1| Signal recognition particle, SRP54 subunit protein [Theobroma cacao] gi|508778637|gb|EOY25893.1| Signal recognition particle, SRP54 subunit protein [Theobroma cacao] Length = 494 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA Sbjct: 454 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 483 >ref|XP_003545781.1| PREDICTED: signal recognition particle 54 kDa protein 2-like [Glycine max] Length = 499 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA Sbjct: 454 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 483 >ref|XP_003543686.1| PREDICTED: signal recognition particle 54 kDa protein 2-like [Glycine max] Length = 500 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA Sbjct: 454 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 483 >gb|ABK95819.1| unknown [Populus trichocarpa] Length = 495 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA Sbjct: 454 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 483 >ref|XP_010279659.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Nelumbo nucifera] Length = 495 Score = 62.8 bits (151), Expect = 9e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGS+ Sbjct: 454 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSS 483 >ref|XP_010259930.1| PREDICTED: signal recognition particle 54 kDa protein 2-like [Nelumbo nucifera] Length = 495 Score = 62.8 bits (151), Expect = 9e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSA 244 HMSKVLPPQMLKQIGGMGGLQNLMKQMGS+ Sbjct: 454 HMSKVLPPQMLKQIGGMGGLQNLMKQMGSS 483 >gb|KJB70637.1| hypothetical protein B456_011G084700 [Gossypium raimondii] Length = 411 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGS 247 HMSKVLPPQMLKQIGGMGGLQNLMKQMGS Sbjct: 369 HMSKVLPPQMLKQIGGMGGLQNLMKQMGS 397 >ref|XP_012455795.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Gossypium raimondii] gi|763803698|gb|KJB70636.1| hypothetical protein B456_011G084700 [Gossypium raimondii] Length = 496 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 333 HMSKVLPPQMLKQIGGMGGLQNLMKQMGS 247 HMSKVLPPQMLKQIGGMGGLQNLMKQMGS Sbjct: 454 HMSKVLPPQMLKQIGGMGGLQNLMKQMGS 482