BLASTX nr result
ID: Forsythia23_contig00015846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00015846 (398 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007025760.1| Uncharacterized protein isoform 2 [Theobroma... 63 9e-08 ref|XP_007025759.1| Uncharacterized protein isoform 1 [Theobroma... 63 9e-08 emb|CBI23472.3| unnamed protein product [Vitis vinifera] 62 1e-07 ref|XP_002268954.2| PREDICTED: transmembrane protein 184 homolog... 62 1e-07 ref|XP_008224968.1| PREDICTED: transmembrane protein 184C [Prunu... 61 3e-07 ref|XP_007211718.1| hypothetical protein PRUPE_ppa009378mg [Prun... 61 3e-07 emb|CAN61223.1| hypothetical protein VITISV_038806 [Vitis vinifera] 61 3e-07 ref|XP_011461975.1| PREDICTED: transmembrane protein 184 homolog... 61 3e-07 ref|XP_011096233.1| PREDICTED: transmembrane protein 184C-like [... 61 3e-07 gb|KDO75773.1| hypothetical protein CISIN_1g020642mg [Citrus sin... 60 4e-07 ref|XP_006467880.1| PREDICTED: transmembrane protein 184C-like [... 60 4e-07 ref|XP_006449236.1| hypothetical protein CICLE_v10016111mg [Citr... 60 4e-07 ref|XP_012091517.1| PREDICTED: transmembrane protein 184C-like [... 60 6e-07 gb|KDP20899.1| hypothetical protein JCGZ_21370 [Jatropha curcas] 60 6e-07 ref|XP_010533868.1| PREDICTED: transmembrane protein 184C [Taren... 60 7e-07 gb|ACU19469.1| unknown [Glycine max] 60 7e-07 ref|XP_008442055.1| PREDICTED: transmembrane protein 184C [Cucum... 59 1e-06 ref|XP_011653027.1| PREDICTED: transmembrane protein 184C [Cucum... 59 1e-06 ref|XP_010057489.1| PREDICTED: transmembrane protein 184C-like [... 58 2e-06 ref|XP_006305467.1| hypothetical protein CARUB_v10009893mg [Caps... 58 2e-06 >ref|XP_007025760.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508781126|gb|EOY28382.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 258 Score = 62.8 bits (151), Expect = 9e-08 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKND 286 LVCLEMVVFSV QQYA++V+PYSG+VEA++KL KKN+ Sbjct: 222 LVCLEMVVFSVLQQYAYHVAPYSGEVEAKMKLGKKNE 258 >ref|XP_007025759.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|590624999|ref|XP_007025761.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508781125|gb|EOY28381.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508781127|gb|EOY28383.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 295 Score = 62.8 bits (151), Expect = 9e-08 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKND 286 LVCLEMVVFSV QQYA++V+PYSG+VEA++KL KKN+ Sbjct: 259 LVCLEMVVFSVLQQYAYHVAPYSGEVEAKMKLGKKNE 295 >emb|CBI23472.3| unnamed protein product [Vitis vinifera] Length = 220 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKND 286 LVC+EMVVFSV QQYAF+V+PYSGD+EA+LKL KK + Sbjct: 184 LVCVEMVVFSVLQQYAFHVAPYSGDMEAKLKLSKKRE 220 >ref|XP_002268954.2| PREDICTED: transmembrane protein 184 homolog DDB_G0279555-like [Vitis vinifera] Length = 295 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKND 286 LVC+EMVVFSV QQYAF+V+PYSGD+EA+LKL KK + Sbjct: 259 LVCVEMVVFSVLQQYAFHVAPYSGDMEAKLKLSKKRE 295 >ref|XP_008224968.1| PREDICTED: transmembrane protein 184C [Prunus mume] Length = 295 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/37 (70%), Positives = 34/37 (91%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKND 286 L+CLEMVVFSV QQYA++V+PYSGDVE+++KL KK + Sbjct: 259 LICLEMVVFSVLQQYAYHVAPYSGDVESKMKLNKKRE 295 >ref|XP_007211718.1| hypothetical protein PRUPE_ppa009378mg [Prunus persica] gi|462407583|gb|EMJ12917.1| hypothetical protein PRUPE_ppa009378mg [Prunus persica] Length = 295 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/37 (70%), Positives = 34/37 (91%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKND 286 L+CLEMVVFSV QQYA++V+PYSGDVE+++KL KK + Sbjct: 259 LICLEMVVFSVLQQYAYHVAPYSGDVESKMKLNKKRE 295 >emb|CAN61223.1| hypothetical protein VITISV_038806 [Vitis vinifera] Length = 295 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKND 286 LVC+EMVVFSV QQYA++V+PYSGD+EA+LKL KK + Sbjct: 259 LVCVEMVVFSVLQQYAYHVAPYSGDMEAKLKLSKKRE 295 >ref|XP_011461975.1| PREDICTED: transmembrane protein 184 homolog DDB_G0279555-like [Fragaria vesca subsp. vesca] Length = 129 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/37 (67%), Positives = 34/37 (91%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKND 286 L+CLEMVVFSV QQYA++V+PYSGDVE ++++ KKN+ Sbjct: 93 LICLEMVVFSVLQQYAYHVAPYSGDVETKMRVNKKNE 129 >ref|XP_011096233.1| PREDICTED: transmembrane protein 184C-like [Sesamum indicum] Length = 295 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/35 (71%), Positives = 34/35 (97%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKK 292 LVC+EMV+FSV QQYA++V+PYSGD+E++LK+QKK Sbjct: 259 LVCVEMVIFSVIQQYAYHVAPYSGDIESKLKMQKK 293 >gb|KDO75773.1| hypothetical protein CISIN_1g020642mg [Citrus sinensis] Length = 323 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKND 286 LVCLEMVVFS+ QQYA+ +PYSGDVEA+LKL KK + Sbjct: 287 LVCLEMVVFSIIQQYAYPATPYSGDVEAKLKLNKKTE 323 >ref|XP_006467880.1| PREDICTED: transmembrane protein 184C-like [Citrus sinensis] gi|641857006|gb|KDO75772.1| hypothetical protein CISIN_1g020642mg [Citrus sinensis] Length = 295 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKND 286 LVCLEMVVFS+ QQYA+ +PYSGDVEA+LKL KK + Sbjct: 259 LVCLEMVVFSIIQQYAYPATPYSGDVEAKLKLNKKTE 295 >ref|XP_006449236.1| hypothetical protein CICLE_v10016111mg [Citrus clementina] gi|557551847|gb|ESR62476.1| hypothetical protein CICLE_v10016111mg [Citrus clementina] Length = 295 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKND 286 LVCLEMVVFS+ QQYA+ +PYSGDVEA+LKL KK + Sbjct: 259 LVCLEMVVFSIIQQYAYPATPYSGDVEAKLKLNKKTE 295 >ref|XP_012091517.1| PREDICTED: transmembrane protein 184C-like [Jatropha curcas] Length = 294 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKN 289 LVCLEMVVFSV QQYA++V+PYSGD EA+++L+KK+ Sbjct: 259 LVCLEMVVFSVLQQYAYHVAPYSGDAEAKMRLKKKD 294 >gb|KDP20899.1| hypothetical protein JCGZ_21370 [Jatropha curcas] Length = 289 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKN 289 LVCLEMVVFSV QQYA++V+PYSGD EA+++L+KK+ Sbjct: 254 LVCLEMVVFSVLQQYAYHVAPYSGDAEAKMRLKKKD 289 >ref|XP_010533868.1| PREDICTED: transmembrane protein 184C [Tarenaya hassleriana] Length = 296 Score = 59.7 bits (143), Expect = 7e-07 Identities = 24/37 (64%), Positives = 33/37 (89%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKND 286 L+CLEM+VFSV QQYAF+V+PYSG+ EA++++ KK D Sbjct: 260 LICLEMIVFSVLQQYAFHVAPYSGETEAKMRINKKKD 296 >gb|ACU19469.1| unknown [Glycine max] Length = 314 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKND*Y 280 LVCLEMV+FSVFQQYA++ +PYSG+VE LK KKN+ Y Sbjct: 260 LVCLEMVIFSVFQQYAYHPAPYSGEVEKMLKQNKKNEWY 298 >ref|XP_008442055.1| PREDICTED: transmembrane protein 184C [Cucumis melo] gi|659067955|ref|XP_008442065.1| PREDICTED: transmembrane protein 184C [Cucumis melo] gi|659067957|ref|XP_008442073.1| PREDICTED: transmembrane protein 184C [Cucumis melo] gi|659067959|ref|XP_008442080.1| PREDICTED: transmembrane protein 184C [Cucumis melo] gi|659067961|ref|XP_008442088.1| PREDICTED: transmembrane protein 184C [Cucumis melo] Length = 294 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKN 289 L+CLEM+VFSV QQYAFNV PYSG+VE +LK++K + Sbjct: 259 LICLEMIVFSVLQQYAFNVGPYSGEVERKLKMRKND 294 >ref|XP_011653027.1| PREDICTED: transmembrane protein 184C [Cucumis sativus] gi|778658646|ref|XP_011653029.1| PREDICTED: transmembrane protein 184C [Cucumis sativus] Length = 294 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKN 289 L+CLEM+VFSV QQYAFNV PYSG+VE +LK++K + Sbjct: 259 LICLEMIVFSVLQQYAFNVGPYSGEVERKLKMRKND 294 >ref|XP_010057489.1| PREDICTED: transmembrane protein 184C-like [Eucalyptus grandis] gi|629109547|gb|KCW74693.1| hypothetical protein EUGRSUZ_E03424 [Eucalyptus grandis] Length = 294 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/36 (69%), Positives = 34/36 (94%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKN 289 LVCLEMVVFSV QQYA++V+PYSG+ E++LKL+K++ Sbjct: 259 LVCLEMVVFSVLQQYAYHVAPYSGETESKLKLKKRD 294 >ref|XP_006305467.1| hypothetical protein CARUB_v10009893mg [Capsella rubella] gi|482574178|gb|EOA38365.1| hypothetical protein CARUB_v10009893mg [Capsella rubella] Length = 294 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = -3 Query: 396 LVCLEMVVFSVFQQYAFNVSPYSGDVEARLKLQKKN 289 LVCLEM+VFSV QQYAF+V+PYSG+ EAR+++ K++ Sbjct: 259 LVCLEMIVFSVIQQYAFHVAPYSGETEARMRMNKRD 294