BLASTX nr result
ID: Forsythia23_contig00015794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00015794 (417 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077103.1| PREDICTED: sister chromatid cohesion 1 prote... 58 3e-06 ref|XP_010242484.1| PREDICTED: sister chromatid cohesion 1 prote... 57 4e-06 ref|XP_012078902.1| PREDICTED: sister chromatid cohesion 1 prote... 57 5e-06 ref|XP_012078900.1| PREDICTED: sister chromatid cohesion 1 prote... 57 5e-06 >ref|XP_011077103.1| PREDICTED: sister chromatid cohesion 1 protein 4 [Sesamum indicum] Length = 1279 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 VLKTRDYIHVEQRNPFDNIDIKPQMKLRKSDF 98 VLKTRDYIHVEQRNPFD+I IKP+ +L KSDF Sbjct: 1248 VLKTRDYIHVEQRNPFDDITIKPRTRLMKSDF 1279 >ref|XP_010242484.1| PREDICTED: sister chromatid cohesion 1 protein 4 [Nelumbo nucifera] Length = 1269 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 VLKTRDYIHVEQRNPFDNIDIKPQMKLRKSDF 98 VLKTRDYIHVEQ NPFD I+IKP++KL KSDF Sbjct: 1238 VLKTRDYIHVEQGNPFDKINIKPKVKLMKSDF 1269 >ref|XP_012078902.1| PREDICTED: sister chromatid cohesion 1 protein 4 isoform X3 [Jatropha curcas] Length = 1037 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 VLKTRDYIHVEQRNPFDNIDIKPQMKLRKSDF 98 VLKTRDY+HVEQ PFDNIDIKP+ KL KS+F Sbjct: 1006 VLKTRDYVHVEQAKPFDNIDIKPRAKLMKSEF 1037 >ref|XP_012078900.1| PREDICTED: sister chromatid cohesion 1 protein 4 isoform X1 [Jatropha curcas] gi|643722734|gb|KDP32484.1| hypothetical protein JCGZ_13409 [Jatropha curcas] Length = 1267 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 VLKTRDYIHVEQRNPFDNIDIKPQMKLRKSDF 98 VLKTRDY+HVEQ PFDNIDIKP+ KL KS+F Sbjct: 1236 VLKTRDYVHVEQAKPFDNIDIKPRAKLMKSEF 1267