BLASTX nr result
ID: Forsythia23_contig00015519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00015519 (451 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP01692.1| unnamed protein product [Coffea canephora] 57 6e-06 >emb|CDP01692.1| unnamed protein product [Coffea canephora] Length = 475 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/41 (68%), Positives = 31/41 (75%), Gaps = 2/41 (4%) Frame = -1 Query: 349 RVNSVNCKKGFVPYKRCLAERD--STVSRDVREEQRIRLCL 233 + S C KGFVPYKRCLAERD S V+ + REEQRIRLCL Sbjct: 435 KAGSGKCTKGFVPYKRCLAERDARSVVNSEEREEQRIRLCL 475