BLASTX nr result
ID: Forsythia23_contig00014579
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00014579 (398 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009796482.1| PREDICTED: 26S proteasome non-ATPase regulat... 142 1e-31 ref|XP_011074567.1| PREDICTED: 26S proteasome non-ATPase regulat... 141 1e-31 gb|AFK41352.1| unknown [Lotus japonicus] 141 1e-31 ref|XP_002264255.1| PREDICTED: 26S proteasome non-ATPase regulat... 141 1e-31 ref|XP_008451917.1| PREDICTED: 26S proteasome non-ATPase regulat... 140 3e-31 ref|XP_004498915.1| PREDICTED: 26S proteasome non-ATPase regulat... 140 3e-31 ref|NP_001241171.1| uncharacterized protein LOC100785835 [Glycin... 140 3e-31 ref|XP_012476849.1| PREDICTED: 26S proteasome non-ATPase regulat... 140 4e-31 gb|KHF99619.1| 26S proteasome non-ATPase regulatory subunit RPN1... 140 4e-31 ref|XP_007029492.1| Regulatory particle non-ATPase 12A isoform 1... 140 4e-31 ref|XP_009613807.1| PREDICTED: 26S proteasome non-ATPase regulat... 139 6e-31 ref|XP_006439298.1| hypothetical protein CICLE_v10021697mg [Citr... 139 1e-30 ref|XP_004505436.1| PREDICTED: 26S proteasome non-ATPase regulat... 139 1e-30 ref|XP_007029493.1| Regulatory particle non-ATPase 12A isoform 2... 138 1e-30 ref|XP_007158973.1| hypothetical protein PHAVU_002G197600g [Phas... 138 2e-30 ref|XP_003589038.1| 26S proteasome non-ATPase regulatory subunit... 137 2e-30 ref|XP_003531078.1| PREDICTED: 26S proteasome non-ATPase regulat... 137 2e-30 ref|XP_010259845.1| PREDICTED: 26S proteasome non-ATPase regulat... 137 4e-30 ref|XP_002518856.1| 26S proteasome non-atpase regulatory subunit... 137 4e-30 ref|XP_010267575.1| PREDICTED: 26S proteasome non-ATPase regulat... 136 5e-30 >ref|XP_009796482.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A-like [Nicotiana sylvestris] Length = 267 Score = 142 bits (357), Expect = 1e-31 Identities = 66/79 (83%), Positives = 74/79 (93%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYDCLSI+D RQ+LLFSSDQEL+EY+++EHPEWEI+NGFV FQ K+SVPCKEIP Sbjct: 189 GCSEKAYDCLSISDARQMLLFSSDQELLEYVREEHPEWEIKNGFVIFQKVKDSVPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLI QTLSYARELERIV Sbjct: 249 SLQLITQTLSYARELERIV 267 >ref|XP_011074567.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A [Sesamum indicum] Length = 267 Score = 141 bits (356), Expect = 1e-31 Identities = 68/79 (86%), Positives = 74/79 (93%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LS+ND RQ+LLFSSD+EL+EYI +EHPEWEI+NG VFFQ AKESVPCKEIP Sbjct: 189 GCSEKAYDSLSLNDARQMLLFSSDKELLEYINEEHPEWEIKNGSVFFQRAKESVPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLINQTLSYARELERIV Sbjct: 249 SLQLINQTLSYARELERIV 267 >gb|AFK41352.1| unknown [Lotus japonicus] Length = 124 Score = 141 bits (356), Expect = 1e-31 Identities = 69/79 (87%), Positives = 73/79 (92%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LSI D RQILL+SSDQEL+EYIK+EHPEWEI+NG VFFQ AKES PCKEIP Sbjct: 46 GCSEKAYDYLSIKDARQILLYSSDQELLEYIKEEHPEWEIKNGSVFFQKAKESAPCKEIP 105 Query: 216 SLQLINQTLSYARELERIV 160 SLQLINQTLSYARELERIV Sbjct: 106 SLQLINQTLSYARELERIV 124 >ref|XP_002264255.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A [Vitis vinifera] gi|297742385|emb|CBI34534.3| unnamed protein product [Vitis vinifera] Length = 267 Score = 141 bits (356), Expect = 1e-31 Identities = 69/79 (87%), Positives = 72/79 (91%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LSIND R +LLFSSDQEL EYIK+EHPEWEI+NG VFFQ AKES PCKEIP Sbjct: 189 GCSEKAYDYLSINDARHMLLFSSDQELFEYIKEEHPEWEIKNGHVFFQRAKESAPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLINQTLSYARELERIV Sbjct: 249 SLQLINQTLSYARELERIV 267 >ref|XP_008451917.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A [Cucumis melo] Length = 267 Score = 140 bits (354), Expect = 3e-31 Identities = 67/79 (84%), Positives = 73/79 (92%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LSIND RQ+LLFSSDQEL++Y+K+EHPEWEI NG V+FQ AKES PCKEIP Sbjct: 189 GCSEKAYDYLSINDARQMLLFSSDQELLDYVKEEHPEWEITNGVVYFQKAKESAPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLINQTLSYARELERIV Sbjct: 249 SLQLINQTLSYARELERIV 267 >ref|XP_004498915.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A-like [Cicer arietinum] Length = 267 Score = 140 bits (354), Expect = 3e-31 Identities = 68/79 (86%), Positives = 73/79 (92%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LS ND +Q+LLFSSDQELVEYIK+EHPEWEI+NG VFFQ AK+S PCKEIP Sbjct: 189 GCSEKAYDYLSTNDAKQMLLFSSDQELVEYIKEEHPEWEIKNGSVFFQKAKDSAPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLINQTLSYARELERIV Sbjct: 249 SLQLINQTLSYARELERIV 267 >ref|NP_001241171.1| uncharacterized protein LOC100785835 [Glycine max] gi|255634606|gb|ACU17665.1| unknown [Glycine max] gi|734388749|gb|KHN25873.1| 26S proteasome non-ATPase regulatory subunit RPN12A [Glycine soja] Length = 267 Score = 140 bits (353), Expect = 3e-31 Identities = 68/79 (86%), Positives = 73/79 (92%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LSI D +Q+LLFSSDQEL+EYIK+EHPEWEI+NG VFFQ AKES PCKEIP Sbjct: 189 GCSEKAYDYLSIKDAKQMLLFSSDQELLEYIKEEHPEWEIKNGSVFFQKAKESAPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLINQTLSYARELERIV Sbjct: 249 SLQLINQTLSYARELERIV 267 >ref|XP_012476849.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A [Gossypium raimondii] gi|763759430|gb|KJB26761.1| hypothetical protein B456_004G260100 [Gossypium raimondii] Length = 267 Score = 140 bits (352), Expect = 4e-31 Identities = 66/79 (83%), Positives = 74/79 (93%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LSIND RQ+LLFSSDQEL+EYIK+EHP+WE++NG V+FQ AK+S PCKEIP Sbjct: 189 GCSEKAYDYLSINDARQMLLFSSDQELLEYIKEEHPDWEVKNGSVYFQKAKDSAPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLINQTLSYARELERIV Sbjct: 249 SLQLINQTLSYARELERIV 267 >gb|KHF99619.1| 26S proteasome non-ATPase regulatory subunit RPN12A -like protein [Gossypium arboreum] Length = 267 Score = 140 bits (352), Expect = 4e-31 Identities = 66/79 (83%), Positives = 74/79 (93%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LSIND RQ+LLFSSDQEL+EYIK+EHP+WE++NG V+FQ AK+S PCKEIP Sbjct: 189 GCSEKAYDYLSINDARQMLLFSSDQELLEYIKEEHPDWEVKNGSVYFQKAKDSAPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLINQTLSYARELERIV Sbjct: 249 SLQLINQTLSYARELERIV 267 >ref|XP_007029492.1| Regulatory particle non-ATPase 12A isoform 1 [Theobroma cacao] gi|508718097|gb|EOY09994.1| Regulatory particle non-ATPase 12A isoform 1 [Theobroma cacao] Length = 267 Score = 140 bits (352), Expect = 4e-31 Identities = 67/79 (84%), Positives = 73/79 (92%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LSI+D RQ+LLFS DQEL+EYIK+EHPEWE++NGFVF Q AKES PCKEIP Sbjct: 189 GCSEKAYDYLSIDDARQMLLFSFDQELLEYIKEEHPEWEVKNGFVFLQKAKESAPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLINQTLSYARELERIV Sbjct: 249 SLQLINQTLSYARELERIV 267 >ref|XP_009613807.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A-like isoform X2 [Nicotiana tomentosiformis] Length = 267 Score = 139 bits (351), Expect = 6e-31 Identities = 65/79 (82%), Positives = 73/79 (92%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYDCLS +D RQ+LLFSSDQEL+EY+++EHPEWEI+NGFV FQ K+SVPCKEIP Sbjct: 189 GCSEKAYDCLSSSDARQMLLFSSDQELLEYVREEHPEWEIKNGFVIFQKVKDSVPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLI QTLSYARELERIV Sbjct: 249 SLQLITQTLSYARELERIV 267 >ref|XP_006439298.1| hypothetical protein CICLE_v10021697mg [Citrus clementina] gi|557541560|gb|ESR52538.1| hypothetical protein CICLE_v10021697mg [Citrus clementina] Length = 267 Score = 139 bits (349), Expect = 1e-30 Identities = 65/79 (82%), Positives = 74/79 (93%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LSI D RQ+LLF+SDQEL+EY+K+EHPEWE+++GFVFFQ AK+S PCKEIP Sbjct: 189 GCSEKAYDYLSIKDARQMLLFTSDQELLEYVKEEHPEWEMKDGFVFFQKAKDSAPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLINQTLSYARELERIV Sbjct: 249 SLQLINQTLSYARELERIV 267 >ref|XP_004505436.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A-like [Cicer arietinum] Length = 267 Score = 139 bits (349), Expect = 1e-30 Identities = 66/79 (83%), Positives = 73/79 (92%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LSIND +Q+LLFSSDQEL+EYIK+EHPEWE++N VFFQ AK+S PCKEIP Sbjct: 189 GCSEKAYDYLSINDAKQMLLFSSDQELLEYIKEEHPEWEVKNNSVFFQKAKDSAPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLINQTLSYARELERIV Sbjct: 249 SLQLINQTLSYARELERIV 267 >ref|XP_007029493.1| Regulatory particle non-ATPase 12A isoform 2, partial [Theobroma cacao] gi|508718098|gb|EOY09995.1| Regulatory particle non-ATPase 12A isoform 2, partial [Theobroma cacao] Length = 194 Score = 138 bits (348), Expect = 1e-30 Identities = 66/78 (84%), Positives = 72/78 (92%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LSI+D RQ+LLFS DQEL+EYIK+EHPEWE++NGFVF Q AKES PCKEIP Sbjct: 117 GCSEKAYDYLSIDDARQMLLFSFDQELLEYIKEEHPEWEVKNGFVFLQKAKESAPCKEIP 176 Query: 216 SLQLINQTLSYARELERI 163 SLQLINQTLSYARELERI Sbjct: 177 SLQLINQTLSYARELERI 194 >ref|XP_007158973.1| hypothetical protein PHAVU_002G197600g [Phaseolus vulgaris] gi|561032388|gb|ESW30967.1| hypothetical protein PHAVU_002G197600g [Phaseolus vulgaris] Length = 267 Score = 138 bits (347), Expect = 2e-30 Identities = 67/79 (84%), Positives = 72/79 (91%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LSI D +Q+LLFSSDQEL+EYIK+EHPEWEI+ G VFFQ AKES PCKEIP Sbjct: 189 GCSEKAYDYLSIKDAKQMLLFSSDQELLEYIKEEHPEWEIKTGSVFFQKAKESAPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLINQTLSYARELERIV Sbjct: 249 SLQLINQTLSYARELERIV 267 >ref|XP_003589038.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula] gi|217074312|gb|ACJ85516.1| unknown [Medicago truncatula] gi|355478086|gb|AES59289.1| 26S proteasome regulatory particle non-ATPase subunit 12 [Medicago truncatula] Length = 267 Score = 137 bits (346), Expect = 2e-30 Identities = 65/79 (82%), Positives = 73/79 (92%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LSIND +Q+LLF+ DQEL+EYIK+EHPEWEI+NG V+FQ AK+S PCKEIP Sbjct: 189 GCSEKAYDYLSINDAKQMLLFTKDQELLEYIKEEHPEWEIKNGSVYFQKAKDSAPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLINQTLSYARELERIV Sbjct: 249 SLQLINQTLSYARELERIV 267 >ref|XP_003531078.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A-like [Glycine max] gi|734417827|gb|KHN39139.1| 26S proteasome non-ATPase regulatory subunit RPN12A [Glycine soja] Length = 267 Score = 137 bits (346), Expect = 2e-30 Identities = 67/79 (84%), Positives = 72/79 (91%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LSI D +Q+LLFSSDQEL+EYIK+EHPEWEI+N VFFQ AKES PCKEIP Sbjct: 189 GCSEKAYDYLSIKDAKQMLLFSSDQELLEYIKEEHPEWEIKNDSVFFQKAKESAPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLINQTLSYARELERIV Sbjct: 249 SLQLINQTLSYARELERIV 267 >ref|XP_010259845.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A-like [Nelumbo nucifera] Length = 267 Score = 137 bits (344), Expect = 4e-30 Identities = 65/79 (82%), Positives = 73/79 (92%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LSI+D +Q+L+FSS+QEL EYI +EHPEWEI+NGFV+FQ AKES PCKEIP Sbjct: 189 GCSEKAYDYLSISDAKQMLMFSSEQELSEYITEEHPEWEIKNGFVYFQKAKESAPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLINQTLSYARELERIV Sbjct: 249 SLQLINQTLSYARELERIV 267 >ref|XP_002518856.1| 26S proteasome non-atpase regulatory subunit, putative [Ricinus communis] gi|223541843|gb|EEF43389.1| 26S proteasome non-atpase regulatory subunit, putative [Ricinus communis] Length = 267 Score = 137 bits (344), Expect = 4e-30 Identities = 65/79 (82%), Positives = 72/79 (91%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LSIND RQ+LLFSSD EL++YIK++HPEWE++NG V FQ AKES PCKEIP Sbjct: 189 GCSEKAYDYLSINDARQMLLFSSDTELLQYIKEDHPEWEVKNGVVIFQKAKESAPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLINQTLSYARELERIV Sbjct: 249 SLQLINQTLSYARELERIV 267 >ref|XP_010267575.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A-like [Nelumbo nucifera] Length = 267 Score = 136 bits (343), Expect = 5e-30 Identities = 65/79 (82%), Positives = 73/79 (92%) Frame = -3 Query: 396 GCSEKAYDCLSINDVRQILLFSSDQELVEYIKKEHPEWEIENGFVFFQLAKESVPCKEIP 217 GCSEKAYD LSI+D RQ+L+FSS+QEL+EYI +EHPEWE++NG VFFQ AKES PCKEIP Sbjct: 189 GCSEKAYDHLSIDDARQMLMFSSEQELLEYITEEHPEWEVKNGSVFFQKAKESAPCKEIP 248 Query: 216 SLQLINQTLSYARELERIV 160 SLQLINQTLSYARELERIV Sbjct: 249 SLQLINQTLSYARELERIV 267