BLASTX nr result
ID: Forsythia23_contig00014523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00014523 (852 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098248.1| PREDICTED: transcription factor GTE4-like is... 64 2e-07 ref|XP_011098247.1| PREDICTED: transcription factor GTE4-like is... 64 2e-07 ref|XP_011098246.1| PREDICTED: transcription factor GTE4-like is... 64 2e-07 >ref|XP_011098248.1| PREDICTED: transcription factor GTE4-like isoform X3 [Sesamum indicum] Length = 863 Score = 63.5 bits (153), Expect = 2e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 562 MASGSVGDLTNGLSSRERVRWTENSKVYTRRFHKKTQKLSINN 434 MASG++GD ++ L+ R R RWTENSKVYTRRFHKK QK S NN Sbjct: 1 MASGTLGDSSDDLNWRGRCRWTENSKVYTRRFHKKAQKSSNNN 43 >ref|XP_011098247.1| PREDICTED: transcription factor GTE4-like isoform X2 [Sesamum indicum] Length = 876 Score = 63.5 bits (153), Expect = 2e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 562 MASGSVGDLTNGLSSRERVRWTENSKVYTRRFHKKTQKLSINN 434 MASG++GD ++ L+ R R RWTENSKVYTRRFHKK QK S NN Sbjct: 1 MASGTLGDSSDDLNWRGRCRWTENSKVYTRRFHKKAQKSSNNN 43 >ref|XP_011098246.1| PREDICTED: transcription factor GTE4-like isoform X1 [Sesamum indicum] Length = 881 Score = 63.5 bits (153), Expect = 2e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 562 MASGSVGDLTNGLSSRERVRWTENSKVYTRRFHKKTQKLSINN 434 MASG++GD ++ L+ R R RWTENSKVYTRRFHKK QK S NN Sbjct: 1 MASGTLGDSSDDLNWRGRCRWTENSKVYTRRFHKKAQKSSNNN 43