BLASTX nr result
ID: Forsythia23_contig00014186
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00014186 (389 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009773253.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 139 1e-30 gb|KJB34588.1| hypothetical protein B456_006G106600 [Gossypium r... 138 1e-30 ref|XP_012485024.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 138 1e-30 ref|XP_011080792.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 138 1e-30 gb|KHG08655.1| Peptidyl-prolyl cis-trans isomerase CYP20-1 -like... 138 1e-30 gb|KCW85440.1| hypothetical protein EUGRSUZ_B02252 [Eucalyptus g... 138 1e-30 ref|XP_010043430.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 138 1e-30 ref|XP_010933260.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 138 2e-30 ref|XP_010933259.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 138 2e-30 ref|XP_004500254.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 138 2e-30 gb|AFK34845.1| unknown [Medicago truncatula] gi|657393449|gb|KEH... 138 2e-30 ref|XP_008464041.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 137 2e-30 ref|XP_009630738.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 137 3e-30 ref|XP_002525647.1| cyclophilin, putative [Ricinus communis] gi|... 137 3e-30 ref|XP_006488528.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 137 3e-30 ref|XP_006425067.1| hypothetical protein CICLE_v10029291mg [Citr... 137 3e-30 gb|ABS30424.1| cyclophilin-like protein [Nicotiana tabacum] 137 3e-30 emb|CAP69837.1| cyclophilin [Ricinus communis] 137 3e-30 gb|KDO66887.1| hypothetical protein CISIN_1g028574mg [Citrus sin... 137 4e-30 gb|AFK44786.1| unknown [Lotus japonicus] 137 4e-30 >ref|XP_009773253.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Nicotiana sylvestris] Length = 206 Score = 139 bits (349), Expect = 1e-30 Identities = 68/69 (98%), Positives = 69/69 (100%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEG+QSGTPKSKVV Sbjct: 138 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGRQSGTPKSKVV 197 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 198 IADSGELPL 206 >gb|KJB34588.1| hypothetical protein B456_006G106600 [Gossypium raimondii] Length = 266 Score = 138 bits (348), Expect = 1e-30 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYK+EAEG+QSGTPKSKVV Sbjct: 139 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQSGTPKSKVV 198 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 199 IADSGELPL 207 >ref|XP_012485024.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Gossypium raimondii] gi|763767372|gb|KJB34587.1| hypothetical protein B456_006G106600 [Gossypium raimondii] Length = 207 Score = 138 bits (348), Expect = 1e-30 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYK+EAEG+QSGTPKSKVV Sbjct: 139 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQSGTPKSKVV 198 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 199 IADSGELPL 207 >ref|XP_011080792.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Sesamum indicum] Length = 205 Score = 138 bits (348), Expect = 1e-30 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV Sbjct: 137 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 196 Query: 207 IADSGELPL 181 I DSGELPL Sbjct: 197 IVDSGELPL 205 >gb|KHG08655.1| Peptidyl-prolyl cis-trans isomerase CYP20-1 -like protein [Gossypium arboreum] Length = 207 Score = 138 bits (348), Expect = 1e-30 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYK+EAEG+QSGTPKSKVV Sbjct: 139 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQSGTPKSKVV 198 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 199 IADSGELPL 207 >gb|KCW85440.1| hypothetical protein EUGRSUZ_B02252 [Eucalyptus grandis] Length = 152 Score = 138 bits (348), Expect = 1e-30 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYK+EAEG+QSGTPKSKVV Sbjct: 84 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQSGTPKSKVV 143 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 144 IADSGELPL 152 >ref|XP_010043430.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Eucalyptus grandis] gi|629120948|gb|KCW85438.1| hypothetical protein EUGRSUZ_B02252 [Eucalyptus grandis] Length = 203 Score = 138 bits (348), Expect = 1e-30 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYK+EAEG+QSGTPKSKVV Sbjct: 135 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQSGTPKSKVV 194 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 195 IADSGELPL 203 >ref|XP_010933260.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 isoform X2 [Elaeis guineensis] Length = 211 Score = 138 bits (347), Expect = 2e-30 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKV+SGMDVVYKIEAEG+QSGTPKSKVV Sbjct: 143 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVISGMDVVYKIEAEGRQSGTPKSKVV 202 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 203 IADSGELPL 211 >ref|XP_010933259.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 isoform X1 [Elaeis guineensis] Length = 215 Score = 138 bits (347), Expect = 2e-30 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKV+SGMDVVYKIEAEG+QSGTPKSKVV Sbjct: 147 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVISGMDVVYKIEAEGRQSGTPKSKVV 206 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 207 IADSGELPL 215 >ref|XP_004500254.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Cicer arietinum] Length = 204 Score = 138 bits (347), Expect = 2e-30 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEG QSGTPKSKVV Sbjct: 136 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGNQSGTPKSKVV 195 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 196 IADSGELPL 204 >gb|AFK34845.1| unknown [Medicago truncatula] gi|657393449|gb|KEH34269.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula] Length = 203 Score = 138 bits (347), Expect = 2e-30 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEG QSGTPKSKVV Sbjct: 135 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGNQSGTPKSKVV 194 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 195 IADSGELPL 203 >ref|XP_008464041.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Cucumis melo] Length = 204 Score = 137 bits (346), Expect = 2e-30 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEG+Q+GTPKSKVV Sbjct: 136 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGRQNGTPKSKVV 195 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 196 IADSGELPL 204 >ref|XP_009630738.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Nicotiana tomentosiformis] Length = 207 Score = 137 bits (345), Expect = 3e-30 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEG QSGTPKSKVV Sbjct: 139 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGGQSGTPKSKVV 198 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 199 IADSGELPL 207 >ref|XP_002525647.1| cyclophilin, putative [Ricinus communis] gi|223535083|gb|EEF36765.1| cyclophilin, putative [Ricinus communis] Length = 204 Score = 137 bits (345), Expect = 3e-30 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEG+QSGTPKSKV Sbjct: 136 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGRQSGTPKSKVT 195 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 196 IADSGELPL 204 >ref|XP_006488528.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Citrus sinensis] Length = 207 Score = 137 bits (345), Expect = 3e-30 Identities = 66/69 (95%), Positives = 69/69 (100%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYK+EAEG+Q+GTPKSKVV Sbjct: 139 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQNGTPKSKVV 198 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 199 IADSGELPL 207 >ref|XP_006425067.1| hypothetical protein CICLE_v10029291mg [Citrus clementina] gi|557527001|gb|ESR38307.1| hypothetical protein CICLE_v10029291mg [Citrus clementina] Length = 207 Score = 137 bits (345), Expect = 3e-30 Identities = 66/69 (95%), Positives = 69/69 (100%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYK+EAEG+Q+GTPKSKVV Sbjct: 139 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQNGTPKSKVV 198 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 199 IADSGELPL 207 >gb|ABS30424.1| cyclophilin-like protein [Nicotiana tabacum] Length = 207 Score = 137 bits (345), Expect = 3e-30 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEG QSGTPKSKVV Sbjct: 139 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGGQSGTPKSKVV 198 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 199 IADSGELPL 207 >emb|CAP69837.1| cyclophilin [Ricinus communis] Length = 133 Score = 137 bits (345), Expect = 3e-30 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEG+QSGTPKSKV Sbjct: 65 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGRQSGTPKSKVT 124 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 125 IADSGELPL 133 >gb|KDO66887.1| hypothetical protein CISIN_1g028574mg [Citrus sinensis] Length = 207 Score = 137 bits (344), Expect = 4e-30 Identities = 65/69 (94%), Positives = 69/69 (100%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYK+EAEG+Q+GTPKSKVV Sbjct: 139 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQNGTPKSKVV 198 Query: 207 IADSGELPL 181 +ADSGELPL Sbjct: 199 VADSGELPL 207 >gb|AFK44786.1| unknown [Lotus japonicus] Length = 204 Score = 137 bits (344), Expect = 4e-30 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = -3 Query: 387 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGKQSGTPKSKVV 208 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKVV Sbjct: 136 LSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKMEAEGNQSGTPKSKVV 195 Query: 207 IADSGELPL 181 IADSGELPL Sbjct: 196 IADSGELPL 204