BLASTX nr result
ID: Forsythia23_contig00014066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00014066 (362 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK25138.1| unknown [Picea sitchensis] 89 2e-21 ref|NP_173156.1| uncharacterized protein [Arabidopsis thaliana] ... 89 3e-21 ref|XP_010476849.1| PREDICTED: coiled-coil domain-containing pro... 89 3e-21 ref|XP_010459279.1| PREDICTED: coiled-coil domain-containing pro... 89 3e-21 ref|XP_010498054.1| PREDICTED: coiled-coil domain-containing pro... 89 3e-21 ref|XP_006305367.1| hypothetical protein CARUB_v10009751mg [Caps... 89 3e-21 ref|XP_010498389.1| PREDICTED: coiled-coil domain-containing pro... 89 3e-21 ref|XP_010477189.1| PREDICTED: coiled-coil domain-containing pro... 88 5e-21 ref|XP_011098112.1| PREDICTED: coiled-coil domain-containing pro... 87 7e-21 ref|XP_012849130.1| PREDICTED: coiled-coil domain-containing pro... 87 7e-21 gb|EPS65319.1| hypothetical protein M569_09461 [Genlisea aurea] 87 7e-21 ref|XP_011098113.1| PREDICTED: coiled-coil domain-containing pro... 87 7e-21 ref|XP_011098114.1| PREDICTED: coiled-coil domain-containing pro... 87 7e-21 ref|XP_010259778.1| PREDICTED: coiled-coil domain-containing pro... 87 1e-20 ref|XP_010259779.1| PREDICTED: coiled-coil domain-containing pro... 87 1e-20 ref|XP_010274808.1| PREDICTED: coiled-coil domain-containing pro... 87 1e-20 ref|XP_010095478.1| hypothetical protein L484_014905 [Morus nota... 87 1e-20 gb|KMT17358.1| hypothetical protein BVRB_2g038150 isoform B [Bet... 87 1e-20 ref|XP_012089591.1| PREDICTED: coiled-coil domain-containing pro... 87 1e-20 ref|XP_004488650.1| PREDICTED: coiled-coil domain-containing pro... 87 1e-20 >gb|ABK25138.1| unknown [Picea sitchensis] Length = 342 Score = 89.0 bits (219), Expect(2) = 2e-21 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI Sbjct: 31 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 2e-21 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >ref|NP_173156.1| uncharacterized protein [Arabidopsis thaliana] gi|5734754|gb|AAD50019.1|AC007651_14 Unknown protein [Arabidopsis thaliana] gi|44681362|gb|AAS47621.1| At1g17130 [Arabidopsis thaliana] gi|45773888|gb|AAS76748.1| At1g17130 [Arabidopsis thaliana] gi|110737612|dbj|BAF00747.1| hypothetical protein [Arabidopsis thaliana] gi|332191424|gb|AEE29545.1| uncharacterized protein AT1G17130 [Arabidopsis thaliana] Length = 331 Score = 88.6 bits (218), Expect(2) = 3e-21 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 IKVRMMLPMS+RCGTCGNYIYKGTKFNSRKEDVIGETYLGI Sbjct: 31 IKVRMMLPMSVRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 3e-21 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >ref|XP_010476849.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Camelina sativa] Length = 325 Score = 88.6 bits (218), Expect(2) = 3e-21 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 IKVRMMLPMS+RCGTCGNYIYKGTKFNSRKEDVIGETYLGI Sbjct: 31 IKVRMMLPMSVRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 3e-21 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >ref|XP_010459279.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Camelina sativa] Length = 325 Score = 88.6 bits (218), Expect(2) = 3e-21 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 IKVRMMLPMS+RCGTCGNYIYKGTKFNSRKEDVIGETYLGI Sbjct: 31 IKVRMMLPMSVRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 3e-21 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >ref|XP_010498054.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Camelina sativa] Length = 325 Score = 88.6 bits (218), Expect(2) = 3e-21 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 IKVRMMLPMS+RCGTCGNYIYKGTKFNSRKEDVIGETYLGI Sbjct: 31 IKVRMMLPMSVRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 3e-21 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >ref|XP_006305367.1| hypothetical protein CARUB_v10009751mg [Capsella rubella] gi|482574078|gb|EOA38265.1| hypothetical protein CARUB_v10009751mg [Capsella rubella] Length = 323 Score = 88.6 bits (218), Expect(2) = 3e-21 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 IKVRMMLPMS+RCGTCGNYIYKGTKFNSRKEDVIGETYLGI Sbjct: 31 IKVRMMLPMSVRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 3e-21 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >ref|XP_010498389.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Camelina sativa] Length = 322 Score = 88.6 bits (218), Expect(2) = 3e-21 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 IKVRMMLPMS+RCGTCGNYIYKGTKFNSRKEDVIGETYLGI Sbjct: 31 IKVRMMLPMSVRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 3e-21 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >ref|XP_010477189.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Camelina sativa] Length = 320 Score = 87.8 bits (216), Expect(2) = 5e-21 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 IKVRMMLPMS+RCGTCGNYIYKGTKFNSRKEDV+GETYLGI Sbjct: 31 IKVRMMLPMSVRCGTCGNYIYKGTKFNSRKEDVLGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 5e-21 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >ref|XP_011098112.1| PREDICTED: coiled-coil domain-containing protein 94 isoform X1 [Sesamum indicum] Length = 335 Score = 87.4 bits (215), Expect(2) = 7e-21 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 +KVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDV+GETYLGI Sbjct: 31 MKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVVGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 7e-21 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >ref|XP_012849130.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Erythranthe guttatus] gi|604346238|gb|EYU44701.1| hypothetical protein MIMGU_mgv1a009831mg [Erythranthe guttata] Length = 330 Score = 87.4 bits (215), Expect(2) = 7e-21 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 +KVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDV+GETYLGI Sbjct: 31 MKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVVGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 7e-21 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >gb|EPS65319.1| hypothetical protein M569_09461 [Genlisea aurea] Length = 320 Score = 87.4 bits (215), Expect(2) = 7e-21 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 +KVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDV+GETYLGI Sbjct: 31 MKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVVGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 7e-21 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >ref|XP_011098113.1| PREDICTED: coiled-coil domain-containing protein 94 isoform X2 [Sesamum indicum] Length = 278 Score = 87.4 bits (215), Expect(2) = 7e-21 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 +KVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDV+GETYLGI Sbjct: 31 MKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVVGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 7e-21 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >ref|XP_011098114.1| PREDICTED: coiled-coil domain-containing protein 94 isoform X3 [Sesamum indicum] Length = 266 Score = 87.4 bits (215), Expect(2) = 7e-21 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 +KVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDV+GETYLGI Sbjct: 31 MKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVVGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 7e-21 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >ref|XP_010259778.1| PREDICTED: coiled-coil domain-containing protein 94 homolog isoform X1 [Nelumbo nucifera] Length = 426 Score = 86.7 bits (213), Expect(2) = 1e-20 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 IKVRMMLPMSIRC TCGNYIYKGTKFNSRKEDVIGETYLGI Sbjct: 31 IKVRMMLPMSIRCNTCGNYIYKGTKFNSRKEDVIGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 1e-20 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >ref|XP_010259779.1| PREDICTED: coiled-coil domain-containing protein 94 homolog isoform X2 [Nelumbo nucifera] Length = 355 Score = 86.7 bits (213), Expect(2) = 1e-20 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 IKVRMMLPMSIRC TCGNYIYKGTKFNSRKEDVIGETYLGI Sbjct: 31 IKVRMMLPMSIRCNTCGNYIYKGTKFNSRKEDVIGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 1e-20 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >ref|XP_010274808.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Nelumbo nucifera] Length = 355 Score = 86.7 bits (213), Expect(2) = 1e-20 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 IKVRMMLPMSIRC TCGNYIYKGTKFNSRKEDVIGETYLGI Sbjct: 31 IKVRMMLPMSIRCNTCGNYIYKGTKFNSRKEDVIGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 1e-20 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >ref|XP_010095478.1| hypothetical protein L484_014905 [Morus notabilis] gi|587871185|gb|EXB60452.1| hypothetical protein L484_014905 [Morus notabilis] Length = 351 Score = 86.7 bits (213), Expect(2) = 1e-20 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 IKVRMMLPMSIRC TCGNYIYKGTKFNSRKEDVIGETYLGI Sbjct: 31 IKVRMMLPMSIRCNTCGNYIYKGTKFNSRKEDVIGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 1e-20 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >gb|KMT17358.1| hypothetical protein BVRB_2g038150 isoform B [Beta vulgaris subsp. vulgaris] Length = 340 Score = 86.7 bits (213), Expect(2) = 1e-20 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 IKVRMMLPMSIRC TCGNYIYKGTKFNSRKEDVIGETYLGI Sbjct: 31 IKVRMMLPMSIRCNTCGNYIYKGTKFNSRKEDVIGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 1e-20 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >ref|XP_012089591.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Jatropha curcas] gi|643707523|gb|KDP23009.1| hypothetical protein JCGZ_01693 [Jatropha curcas] Length = 330 Score = 86.7 bits (213), Expect(2) = 1e-20 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 IKVRMMLPMSIRC TCGNYIYKGTKFNSRKEDVIGETYLGI Sbjct: 31 IKVRMMLPMSIRCNTCGNYIYKGTKFNSRKEDVIGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 1e-20 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16 >ref|XP_004488650.1| PREDICTED: coiled-coil domain-containing protein 94 [Cicer arietinum] gi|502087813|ref|XP_004488651.1| PREDICTED: coiled-coil domain-containing protein 94 [Cicer arietinum] gi|828292091|ref|XP_012567716.1| PREDICTED: coiled-coil domain-containing protein 94 [Cicer arietinum] Length = 330 Score = 86.7 bits (213), Expect(2) = 1e-20 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +2 Query: 239 IKVRMMLPMSIRCGTCGNYIYKGTKFNSRKEDVIGETYLGI 361 IKVRMMLPMSIRC TCGNYIYKGTKFNSRKEDVIGETYLGI Sbjct: 31 IKVRMMLPMSIRCNTCGNYIYKGTKFNSRKEDVIGETYLGI 71 Score = 39.7 bits (91), Expect(2) = 1e-20 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 148 MGERKVLNKYYPPDFD 195 MGERKVLNKYYPPDFD Sbjct: 1 MGERKVLNKYYPPDFD 16