BLASTX nr result
ID: Forsythia23_contig00013735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00013735 (396 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF63702.1| mixed amyrin synthase [Olea europaea] 183 4e-44 emb|CDP12624.1| unnamed protein product [Coffea canephora] 163 5e-38 ref|XP_011096562.1| PREDICTED: dammarenediol II synthase-like [S... 157 2e-36 gb|AIS39793.1| mixed amyrin synthase 1 [Ilex asprella var. aspre... 157 3e-36 gb|AEX99665.1| amyrin synthase [Catharanthus roseus] 156 6e-36 gb|AFJ19235.1| mixed amyrin synthase [Catharanthus roseus] 154 2e-35 ref|XP_012842229.1| PREDICTED: dammarenediol II synthase-like [E... 153 5e-35 gb|ADM86392.1| putative beta-amyrin synthase [Bacopa monnieri] 153 5e-35 ref|XP_012841448.1| PREDICTED: dammarenediol II synthase-like [E... 150 2e-34 gb|EYU34015.1| hypothetical protein MIMGU_mgv1a021513mg [Erythra... 150 2e-34 emb|CDP10664.1| unnamed protein product [Coffea canephora] 149 9e-34 gb|AAS01523.1| putative beta-amyrin synthase [Centella asiatica] 144 2e-32 gb|AGK62449.1| dammarenediol-II synthase [Panax quinquefolius] 143 4e-32 gb|AGI15962.1| dammarenediol synthase [Panax quinquefolius] 143 4e-32 gb|AED99864.1| DS synthase [Panax quinquefolius] 143 4e-32 gb|AHF22084.1| OSC2 [Artemisia annua] 142 9e-32 gb|ACZ71036.1| dammarenediol synthase protein [Panax ginseng] 142 9e-32 dbj|BAD15332.1| beta-amyrin synthase [Panax ginseng] 142 9e-32 gb|AIK21788.1| dammarenediol-II synthase [Panax notoginseng] 142 1e-31 gb|AFH53506.1| 2,3-oxidosqualene cyclase 2 [Ocimum basilicum] 141 1e-31 >dbj|BAF63702.1| mixed amyrin synthase [Olea europaea] Length = 762 Score = 183 bits (464), Expect = 4e-44 Identities = 85/90 (94%), Positives = 87/90 (96%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVHPC 93 MWKLKIAEG+GPYLYSTNNF GRQIWEY+PN GTPEEREAYDKAREEFQRNRKLKGVHPC Sbjct: 1 MWKLKIAEGHGPYLYSTNNFAGRQIWEYDPNGGTPEEREAYDKAREEFQRNRKLKGVHPC 60 Query: 92 GDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 GDLFMRIQL KESGIDLMSIPPVRLGEKEE Sbjct: 61 GDLFMRIQLIKESGIDLMSIPPVRLGEKEE 90 >emb|CDP12624.1| unnamed protein product [Coffea canephora] Length = 761 Score = 163 bits (412), Expect = 5e-38 Identities = 75/90 (83%), Positives = 84/90 (93%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVHPC 93 MWKLKIAEG+GPYLYSTNNF GRQIWEY+ N+GTPEEREA++KAREEF +NRK KGVHPC Sbjct: 1 MWKLKIAEGHGPYLYSTNNFAGRQIWEYDSNAGTPEEREAFEKAREEFTKNRK-KGVHPC 59 Query: 92 GDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 GDLFMR+QL KESGIDL+SIPP+RLGE EE Sbjct: 60 GDLFMRMQLIKESGIDLLSIPPIRLGENEE 89 >ref|XP_011096562.1| PREDICTED: dammarenediol II synthase-like [Sesamum indicum] gi|747097217|ref|XP_011096564.1| PREDICTED: dammarenediol II synthase-like [Sesamum indicum] Length = 761 Score = 157 bits (398), Expect = 2e-36 Identities = 73/90 (81%), Positives = 81/90 (90%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVHPC 93 MWKLKIAEG+GPYLYSTNNFVGRQIWEY+PN GTPEER+A+ KAREEF NRK KG H C Sbjct: 1 MWKLKIAEGHGPYLYSTNNFVGRQIWEYDPNGGTPEERQAFQKAREEFNENRK-KGFHSC 59 Query: 92 GDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 DLFMR+QL +ESGIDL+SIPPVR+GEKEE Sbjct: 60 ADLFMRMQLKRESGIDLLSIPPVRVGEKEE 89 >gb|AIS39793.1| mixed amyrin synthase 1 [Ilex asprella var. asprella] Length = 762 Score = 157 bits (397), Expect = 3e-36 Identities = 72/90 (80%), Positives = 82/90 (91%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVHPC 93 MWKLKIAEG GPYLYSTNNFVGRQIWEYEP +GTPEERE +KARE F++NRK +G+HPC Sbjct: 1 MWKLKIAEGKGPYLYSTNNFVGRQIWEYEPEAGTPEEREEVEKARETFRKNRK-QGIHPC 59 Query: 92 GDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 GDL MR+Q+ KESGID++SIPPVRLGEKEE Sbjct: 60 GDLLMRMQMKKESGIDVLSIPPVRLGEKEE 89 >gb|AEX99665.1| amyrin synthase [Catharanthus roseus] Length = 762 Score = 156 bits (394), Expect = 6e-36 Identities = 74/91 (81%), Positives = 84/91 (92%), Gaps = 1/91 (1%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVH-P 96 MWKLKIAEG GPYLYSTNNFVGRQIWEY+PN+GTP+EREA++KARE+F+ NRK KGVH P Sbjct: 1 MWKLKIAEGKGPYLYSTNNFVGRQIWEYDPNAGTPQEREAFEKAREQFRNNRK-KGVHNP 59 Query: 95 CGDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 C DLFMR+QL KE+GIDLMSIPPVR+ EKEE Sbjct: 60 CADLFMRMQLIKENGIDLMSIPPVRVEEKEE 90 >gb|AFJ19235.1| mixed amyrin synthase [Catharanthus roseus] Length = 762 Score = 154 bits (390), Expect = 2e-35 Identities = 73/91 (80%), Positives = 84/91 (92%), Gaps = 1/91 (1%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVH-P 96 MWKLKIA+G GPYLYSTNNFVGRQIWEY+PN+GTP+EREA++KARE+F+ NRK KGVH P Sbjct: 1 MWKLKIAKGKGPYLYSTNNFVGRQIWEYDPNAGTPQEREAFEKAREQFRNNRK-KGVHNP 59 Query: 95 CGDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 C DLFMR+QL KE+GIDLMSIPPVR+ EKEE Sbjct: 60 CADLFMRMQLIKENGIDLMSIPPVRVEEKEE 90 >ref|XP_012842229.1| PREDICTED: dammarenediol II synthase-like [Erythranthe guttatus] gi|848883891|ref|XP_012842230.1| PREDICTED: dammarenediol II synthase-like [Erythranthe guttatus] gi|604327610|gb|EYU33367.1| hypothetical protein MIMGU_mgv1a001775mg [Erythranthe guttata] Length = 761 Score = 153 bits (386), Expect = 5e-35 Identities = 72/90 (80%), Positives = 80/90 (88%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVHPC 93 MWKLKIAEGNGPYLYSTNNFVGRQ WEY+PN+GTPE+RE++ KAR+ F +NRK KG H C Sbjct: 1 MWKLKIAEGNGPYLYSTNNFVGRQTWEYDPNAGTPEDRESFQKARDIFDQNRK-KGFHSC 59 Query: 92 GDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 GDLFMR+QL KESGIDL SIPPVRL EKEE Sbjct: 60 GDLFMRMQLKKESGIDLESIPPVRLEEKEE 89 >gb|ADM86392.1| putative beta-amyrin synthase [Bacopa monnieri] Length = 764 Score = 153 bits (386), Expect = 5e-35 Identities = 71/90 (78%), Positives = 79/90 (87%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVHPC 93 MW+LKIAEG GPYLYSTNNFVGRQ WEY+PN GT EEREA++KAR+EF NRK KGVH C Sbjct: 1 MWRLKIAEGQGPYLYSTNNFVGRQTWEYDPNGGTAEEREAFEKARQEFNENRK-KGVHCC 59 Query: 92 GDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 DLFMR+QL KESGIDL+ IPPVR+GEKEE Sbjct: 60 ADLFMRLQLKKESGIDLLQIPPVRVGEKEE 89 >ref|XP_012841448.1| PREDICTED: dammarenediol II synthase-like [Erythranthe guttatus] Length = 777 Score = 150 bits (380), Expect = 2e-34 Identities = 70/90 (77%), Positives = 80/90 (88%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVHPC 93 MWKLKIAEGNGPYLYSTNNFVGRQ WEY+PN+GTPE+RE++ KAR++F +NR +KG H C Sbjct: 1 MWKLKIAEGNGPYLYSTNNFVGRQTWEYDPNAGTPEDRESFQKARDQFDQNR-IKGFHSC 59 Query: 92 GDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 GDLFMR+QL KESGIDL SIP VRL EKEE Sbjct: 60 GDLFMRMQLKKESGIDLESIPAVRLEEKEE 89 >gb|EYU34015.1| hypothetical protein MIMGU_mgv1a021513mg [Erythranthe guttata] Length = 727 Score = 150 bits (380), Expect = 2e-34 Identities = 70/90 (77%), Positives = 80/90 (88%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVHPC 93 MWKLKIAEGNGPYLYSTNNFVGRQ WEY+PN+GTPE+RE++ KAR++F +NR +KG H C Sbjct: 1 MWKLKIAEGNGPYLYSTNNFVGRQTWEYDPNAGTPEDRESFQKARDQFDQNR-IKGFHSC 59 Query: 92 GDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 GDLFMR+QL KESGIDL SIP VRL EKEE Sbjct: 60 GDLFMRMQLKKESGIDLESIPAVRLEEKEE 89 >emb|CDP10664.1| unnamed protein product [Coffea canephora] Length = 761 Score = 149 bits (375), Expect = 9e-34 Identities = 69/90 (76%), Positives = 79/90 (87%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVHPC 93 MW+LKIAEGNGPYLYSTNNFVGRQIWE++PN GTPEEREA++KARE+F+ NRK KGVHPC Sbjct: 1 MWRLKIAEGNGPYLYSTNNFVGRQIWEWDPNDGTPEEREAFEKAREDFRNNRK-KGVHPC 59 Query: 92 GDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 DLFMR+QL KE+ + IPPVRLGE EE Sbjct: 60 ADLFMRMQLKKENSHIDLGIPPVRLGENEE 89 >gb|AAS01523.1| putative beta-amyrin synthase [Centella asiatica] Length = 760 Score = 144 bits (364), Expect = 2e-32 Identities = 65/90 (72%), Positives = 77/90 (85%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVHPC 93 MWKLKIAEGNG YLYSTNNFVGRQIWEY+P++GTPEER +K RE ++ N G+HPC Sbjct: 1 MWKLKIAEGNGAYLYSTNNFVGRQIWEYDPDAGTPEERLEVEKLRETYKYNLINNGIHPC 60 Query: 92 GDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 GD+ MR+QL KESG+DL+SIPPVRLGE+EE Sbjct: 61 GDMLMRLQLIKESGLDLLSIPPVRLGEQEE 90 >gb|AGK62449.1| dammarenediol-II synthase [Panax quinquefolius] Length = 769 Score = 143 bits (361), Expect = 4e-32 Identities = 62/90 (68%), Positives = 77/90 (85%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVHPC 93 MWKLK+A+GN PYLYSTNNFVGRQ WE++P++GTPEERE +KAR+++ N+KL G+HPC Sbjct: 1 MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC 60 Query: 92 GDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 D+ MR QL KESGIDL+SIPPVRL E E+ Sbjct: 61 SDMLMRRQLIKESGIDLLSIPPVRLDENEQ 90 >gb|AGI15962.1| dammarenediol synthase [Panax quinquefolius] Length = 769 Score = 143 bits (361), Expect = 4e-32 Identities = 62/90 (68%), Positives = 77/90 (85%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVHPC 93 MWKLK+A+GN PYLYSTNNFVGRQ WE++P++GTPEERE +KAR+++ N+KL G+HPC Sbjct: 1 MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC 60 Query: 92 GDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 D+ MR QL KESGIDL+SIPPVRL E E+ Sbjct: 61 SDMLMRRQLIKESGIDLLSIPPVRLDENEQ 90 >gb|AED99864.1| DS synthase [Panax quinquefolius] Length = 769 Score = 143 bits (361), Expect = 4e-32 Identities = 62/90 (68%), Positives = 77/90 (85%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVHPC 93 MWKLK+A+GN PYLYSTNNFVGRQ WE++P++GTPEERE +KAR+++ N+KL G+HPC Sbjct: 1 MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC 60 Query: 92 GDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 D+ MR QL KESGIDL+SIPPVRL E E+ Sbjct: 61 SDMLMRRQLIKESGIDLLSIPPVRLDENEQ 90 >gb|AHF22084.1| OSC2 [Artemisia annua] Length = 760 Score = 142 bits (358), Expect = 9e-32 Identities = 63/90 (70%), Positives = 80/90 (88%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVHPC 93 MWKLK+AEGN PYL+STNNFVGRQIWE++P++G+P ER+ + AR++F+ NR+ +GVHPC Sbjct: 1 MWKLKVAEGNDPYLFSTNNFVGRQIWEFDPSAGSPVERQEVEDARQQFKNNRR-EGVHPC 59 Query: 92 GDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 GDL MRIQL KE+GID+MSIPPVRLGE E+ Sbjct: 60 GDLLMRIQLIKENGIDVMSIPPVRLGENED 89 >gb|ACZ71036.1| dammarenediol synthase protein [Panax ginseng] Length = 769 Score = 142 bits (358), Expect = 9e-32 Identities = 61/90 (67%), Positives = 77/90 (85%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVHPC 93 MWKLK+A+GN PYLYSTNNFVGRQ WE++P++GTPEERE +KAR+++ N+KL G+HPC Sbjct: 1 MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC 60 Query: 92 GDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 D+ MR QL KESGIDL+SIPP+RL E E+ Sbjct: 61 SDMLMRRQLIKESGIDLLSIPPLRLDENEQ 90 >dbj|BAD15332.1| beta-amyrin synthase [Panax ginseng] Length = 769 Score = 142 bits (358), Expect = 9e-32 Identities = 61/90 (67%), Positives = 77/90 (85%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVHPC 93 MWKLK+A+GN PYLYSTNNFVGRQ WE++P++GTPEERE +KAR+++ N+KL G+HPC Sbjct: 1 MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVEKARKDYVNNKKLHGIHPC 60 Query: 92 GDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 D+ MR QL KESGIDL+SIPP+RL E E+ Sbjct: 61 SDMLMRRQLIKESGIDLLSIPPLRLDENEQ 90 >gb|AIK21788.1| dammarenediol-II synthase [Panax notoginseng] Length = 769 Score = 142 bits (357), Expect = 1e-31 Identities = 62/90 (68%), Positives = 76/90 (84%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEEREAYDKAREEFQRNRKLKGVHPC 93 MWKLK+A+GN PYLYSTNNFVGRQ WE++P++GTPEERE + AR+++ N+KL GVHPC Sbjct: 1 MWKLKVAQGNDPYLYSTNNFVGRQYWEFQPDAGTPEEREEVENARKDYVNNKKLHGVHPC 60 Query: 92 GDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 D+ MR QL KESGIDL+SIPPVRL E E+ Sbjct: 61 SDMLMRRQLIKESGIDLLSIPPVRLDENEQ 90 >gb|AFH53506.1| 2,3-oxidosqualene cyclase 2 [Ocimum basilicum] Length = 765 Score = 141 bits (356), Expect = 1e-31 Identities = 68/94 (72%), Positives = 79/94 (84%), Gaps = 4/94 (4%) Frame = -2 Query: 272 MWKLKIAEGNGPYLYSTNNFVGRQIWEYEPNSGTPEE----REAYDKAREEFQRNRKLKG 105 MWKLKIAEGN PYLYSTNNFVGRQIWE++ N+GTPEE REA+ KAR+E+ RK KG Sbjct: 1 MWKLKIAEGNNPYLYSTNNFVGRQIWEFDHNAGTPEEREAQREAFQKARDEWSEGRK-KG 59 Query: 104 VHPCGDLFMRIQLTKESGIDLMSIPPVRLGEKEE 3 H CGDLF+R+QL +ESGIDL+SIPPVR+GE EE Sbjct: 60 FHSCGDLFLRLQLKEESGIDLLSIPPVRVGEDEE 93