BLASTX nr result
ID: Forsythia23_contig00013237
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00013237 (486 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32677.3| unnamed protein product [Vitis vinifera] 105 9e-21 ref|XP_002278566.1| PREDICTED: diaminopimelate epimerase, chloro... 105 9e-21 ref|XP_010037877.1| PREDICTED: diaminopimelate epimerase, chloro... 104 3e-20 gb|KCW49656.1| hypothetical protein EUGRSUZ_K03171 [Eucalyptus g... 104 3e-20 ref|XP_007027115.1| Diaminopimelate epimerase family protein iso... 103 4e-20 emb|CDP06656.1| unnamed protein product [Coffea canephora] 103 6e-20 ref|XP_012443441.1| PREDICTED: diaminopimelate epimerase, chloro... 102 8e-20 gb|KJB62581.1| hypothetical protein B456_009G423800 [Gossypium r... 102 8e-20 gb|KJB62580.1| hypothetical protein B456_009G423800 [Gossypium r... 102 8e-20 gb|KJB62579.1| hypothetical protein B456_009G423800 [Gossypium r... 102 8e-20 gb|KJB62578.1| hypothetical protein B456_009G423800 [Gossypium r... 102 8e-20 ref|XP_011094810.1| PREDICTED: diaminopimelate epimerase, chloro... 102 8e-20 ref|XP_004142088.1| PREDICTED: diaminopimelate epimerase, chloro... 102 1e-19 ref|XP_010670422.1| PREDICTED: diaminopimelate epimerase, chloro... 102 1e-19 ref|XP_008241580.1| PREDICTED: diaminopimelate epimerase, chloro... 102 1e-19 ref|XP_007205407.1| hypothetical protein PRUPE_ppa007581mg [Prun... 102 1e-19 ref|XP_010097384.1| Diaminopimelate epimerase [Morus notabilis] ... 101 2e-19 ref|XP_008447504.1| PREDICTED: diaminopimelate epimerase, chloro... 101 2e-19 ref|XP_009794625.1| PREDICTED: diaminopimelate epimerase, chloro... 100 3e-19 ref|XP_011019080.1| PREDICTED: diaminopimelate epimerase, chloro... 100 4e-19 >emb|CBI32677.3| unnamed protein product [Vitis vinifera] Length = 307 Score = 105 bits (263), Expect = 9e-21 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSIPL 332 VVVAAVLEG AGRSCTVDLPGGPLDIEWREEDNH+YMTGPAE+VFYGS+PL Sbjct: 257 VVVAAVLEGHAGRSCTVDLPGGPLDIEWREEDNHVYMTGPAEIVFYGSVPL 307 >ref|XP_002278566.1| PREDICTED: diaminopimelate epimerase, chloroplastic [Vitis vinifera] Length = 370 Score = 105 bits (263), Expect = 9e-21 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSIPL 332 VVVAAVLEG AGRSCTVDLPGGPLDIEWREEDNH+YMTGPAE+VFYGS+PL Sbjct: 320 VVVAAVLEGHAGRSCTVDLPGGPLDIEWREEDNHVYMTGPAEIVFYGSVPL 370 >ref|XP_010037877.1| PREDICTED: diaminopimelate epimerase, chloroplastic [Eucalyptus grandis] gi|629083212|gb|KCW49657.1| hypothetical protein EUGRSUZ_K03171 [Eucalyptus grandis] Length = 376 Score = 104 bits (259), Expect = 3e-20 Identities = 46/51 (90%), Positives = 51/51 (100%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSIPL 332 VVVAAVLEGRAGRSCTVDLPGGPL+IEWRE+DNH+YMTGPAEVVFYGS+P+ Sbjct: 326 VVVAAVLEGRAGRSCTVDLPGGPLEIEWREKDNHVYMTGPAEVVFYGSVPI 376 >gb|KCW49656.1| hypothetical protein EUGRSUZ_K03171 [Eucalyptus grandis] Length = 373 Score = 104 bits (259), Expect = 3e-20 Identities = 46/51 (90%), Positives = 51/51 (100%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSIPL 332 VVVAAVLEGRAGRSCTVDLPGGPL+IEWRE+DNH+YMTGPAEVVFYGS+P+ Sbjct: 323 VVVAAVLEGRAGRSCTVDLPGGPLEIEWREKDNHVYMTGPAEVVFYGSVPI 373 >ref|XP_007027115.1| Diaminopimelate epimerase family protein isoform 1 [Theobroma cacao] gi|508715720|gb|EOY07617.1| Diaminopimelate epimerase family protein isoform 1 [Theobroma cacao] Length = 361 Score = 103 bits (257), Expect = 4e-20 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSIPL 332 VVVAAVLEGRAGRSCTVDLPGG L+IEWREEDNH+YMTGPAEVVFYGS+PL Sbjct: 311 VVVAAVLEGRAGRSCTVDLPGGTLEIEWREEDNHVYMTGPAEVVFYGSVPL 361 >emb|CDP06656.1| unnamed protein product [Coffea canephora] Length = 385 Score = 103 bits (256), Expect = 6e-20 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSIPL 332 VVVAAVLEG AGRSCTVDLPGGPL+IEWREE+NHIYMTGPAEVVFYGS+PL Sbjct: 335 VVVAAVLEGHAGRSCTVDLPGGPLEIEWREENNHIYMTGPAEVVFYGSVPL 385 >ref|XP_012443441.1| PREDICTED: diaminopimelate epimerase, chloroplastic [Gossypium raimondii] gi|763795586|gb|KJB62582.1| hypothetical protein B456_009G423800 [Gossypium raimondii] Length = 362 Score = 102 bits (255), Expect = 8e-20 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSI 338 VVVAAVLEGRAGRSCTVDLPGGPLDIEW+EEDNH+YMTGPAEVVFYGS+ Sbjct: 312 VVVAAVLEGRAGRSCTVDLPGGPLDIEWKEEDNHVYMTGPAEVVFYGSV 360 >gb|KJB62581.1| hypothetical protein B456_009G423800 [Gossypium raimondii] Length = 363 Score = 102 bits (255), Expect = 8e-20 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSI 338 VVVAAVLEGRAGRSCTVDLPGGPLDIEW+EEDNH+YMTGPAEVVFYGS+ Sbjct: 313 VVVAAVLEGRAGRSCTVDLPGGPLDIEWKEEDNHVYMTGPAEVVFYGSV 361 >gb|KJB62580.1| hypothetical protein B456_009G423800 [Gossypium raimondii] Length = 319 Score = 102 bits (255), Expect = 8e-20 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSI 338 VVVAAVLEGRAGRSCTVDLPGGPLDIEW+EEDNH+YMTGPAEVVFYGS+ Sbjct: 269 VVVAAVLEGRAGRSCTVDLPGGPLDIEWKEEDNHVYMTGPAEVVFYGSV 317 >gb|KJB62579.1| hypothetical protein B456_009G423800 [Gossypium raimondii] Length = 336 Score = 102 bits (255), Expect = 8e-20 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSI 338 VVVAAVLEGRAGRSCTVDLPGGPLDIEW+EEDNH+YMTGPAEVVFYGS+ Sbjct: 286 VVVAAVLEGRAGRSCTVDLPGGPLDIEWKEEDNHVYMTGPAEVVFYGSV 334 >gb|KJB62578.1| hypothetical protein B456_009G423800 [Gossypium raimondii] Length = 342 Score = 102 bits (255), Expect = 8e-20 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSI 338 VVVAAVLEGRAGRSCTVDLPGGPLDIEW+EEDNH+YMTGPAEVVFYGS+ Sbjct: 292 VVVAAVLEGRAGRSCTVDLPGGPLDIEWKEEDNHVYMTGPAEVVFYGSV 340 >ref|XP_011094810.1| PREDICTED: diaminopimelate epimerase, chloroplastic [Sesamum indicum] Length = 366 Score = 102 bits (255), Expect = 8e-20 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSIPL 332 VVVAAVLEGRA RSCTVDLPGGPLDIEWRE DNH+YMTGPAEVVFYGS+PL Sbjct: 316 VVVAAVLEGRAERSCTVDLPGGPLDIEWREADNHVYMTGPAEVVFYGSVPL 366 >ref|XP_004142088.1| PREDICTED: diaminopimelate epimerase, chloroplastic [Cucumis sativus] gi|700199063|gb|KGN54221.1| hypothetical protein Csa_4G293310 [Cucumis sativus] Length = 364 Score = 102 bits (254), Expect = 1e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSIPL 332 VVVAAVLEGRAGR+CTVDLPGGPL IEW EEDNH+YMTGPAEVVFYGS+PL Sbjct: 313 VVVAAVLEGRAGRNCTVDLPGGPLQIEWSEEDNHVYMTGPAEVVFYGSVPL 363 >ref|XP_010670422.1| PREDICTED: diaminopimelate epimerase, chloroplastic [Beta vulgaris subsp. vulgaris] gi|870866038|gb|KMT17057.1| hypothetical protein BVRB_2g041180 [Beta vulgaris subsp. vulgaris] Length = 365 Score = 102 bits (253), Expect = 1e-19 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSIPL 332 VVVAAVLEGR+ R+CTVDLPGGPL+IEWREEDNHIYMTGPAEVVFYGS+PL Sbjct: 315 VVVAAVLEGRSDRNCTVDLPGGPLEIEWREEDNHIYMTGPAEVVFYGSVPL 365 >ref|XP_008241580.1| PREDICTED: diaminopimelate epimerase, chloroplastic [Prunus mume] Length = 363 Score = 102 bits (253), Expect = 1e-19 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSIPL 332 VVVAAVLEGRA R+CTVDLPGGPL IEWREEDNHIYMTGPAEVVFYGS+PL Sbjct: 313 VVVAAVLEGRAERNCTVDLPGGPLQIEWREEDNHIYMTGPAEVVFYGSVPL 363 >ref|XP_007205407.1| hypothetical protein PRUPE_ppa007581mg [Prunus persica] gi|462401049|gb|EMJ06606.1| hypothetical protein PRUPE_ppa007581mg [Prunus persica] Length = 363 Score = 102 bits (253), Expect = 1e-19 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSIPL 332 VVVAAVLEGRA R+CTVDLPGGPL IEWREEDNHIYMTGPAEVVFYGS+PL Sbjct: 313 VVVAAVLEGRAERNCTVDLPGGPLQIEWREEDNHIYMTGPAEVVFYGSVPL 363 >ref|XP_010097384.1| Diaminopimelate epimerase [Morus notabilis] gi|587878904|gb|EXB67890.1| Diaminopimelate epimerase [Morus notabilis] Length = 359 Score = 101 bits (251), Expect = 2e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSIPL 332 VVVAAVLEGRAGR+CTVDLPGGPL IEWREEDNH+YMTGPAEVVFYGS+ L Sbjct: 309 VVVAAVLEGRAGRNCTVDLPGGPLQIEWREEDNHVYMTGPAEVVFYGSVRL 359 >ref|XP_008447504.1| PREDICTED: diaminopimelate epimerase, chloroplastic [Cucumis melo] Length = 364 Score = 101 bits (251), Expect = 2e-19 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSIPL 332 VVVAAVLEGRAGR+CTVDLPGGPL IEW E+DNH+YMTGPAEVVFYGS+PL Sbjct: 313 VVVAAVLEGRAGRNCTVDLPGGPLQIEWSEQDNHVYMTGPAEVVFYGSVPL 363 >ref|XP_009794625.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like [Nicotiana sylvestris] gi|698497252|ref|XP_009794626.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like [Nicotiana sylvestris] gi|698497255|ref|XP_009794627.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like [Nicotiana sylvestris] Length = 367 Score = 100 bits (250), Expect = 3e-19 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -3 Query: 484 VVVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSIPL 332 VVVAAVLEGRA R CTVDLPGGPLDIEW E+DNHIYMTGPAEVVFYGS+PL Sbjct: 317 VVVAAVLEGRAARRCTVDLPGGPLDIEWNEKDNHIYMTGPAEVVFYGSVPL 367 >ref|XP_011019080.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like [Populus euphratica] Length = 387 Score = 100 bits (249), Expect = 4e-19 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = -3 Query: 481 VVAAVLEGRAGRSCTVDLPGGPLDIEWREEDNHIYMTGPAEVVFYGSIPL 332 VVAAVLEGRAGR+CTVDLPGGPL+IEWREEDNH+YMTGPAEVVFYGS+ L Sbjct: 338 VVAAVLEGRAGRNCTVDLPGGPLEIEWREEDNHVYMTGPAEVVFYGSVRL 387