BLASTX nr result
ID: Forsythia23_contig00012992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00012992 (353 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079611.1| PREDICTED: nicotinamide adenine dinucleotide... 92 2e-16 ref|XP_009594055.1| PREDICTED: nicotinamide adenine dinucleotide... 92 2e-16 ref|XP_012082829.1| PREDICTED: nicotinamide adenine dinucleotide... 90 7e-16 ref|XP_010326568.1| PREDICTED: nicotinamide adenine dinucleotide... 89 1e-15 ref|XP_006359875.1| PREDICTED: nicotinamide adenine dinucleotide... 89 1e-15 ref|XP_009784346.1| PREDICTED: nicotinamide adenine dinucleotide... 89 1e-15 ref|XP_008451527.1| PREDICTED: LOW QUALITY PROTEIN: nicotinamide... 88 2e-15 ref|XP_012833926.1| PREDICTED: nicotinamide adenine dinucleotide... 87 6e-15 ref|XP_011659376.1| PREDICTED: nicotinamide adenine dinucleotide... 86 7e-15 ref|XP_004136010.1| PREDICTED: nicotinamide adenine dinucleotide... 86 7e-15 ref|XP_002273574.1| PREDICTED: nicotinamide adenine dinucleotide... 86 1e-14 ref|XP_010259427.1| PREDICTED: nicotinamide adenine dinucleotide... 85 2e-14 ref|XP_010259426.1| PREDICTED: nicotinamide adenine dinucleotide... 85 2e-14 ref|XP_011007801.1| PREDICTED: nicotinamide adenine dinucleotide... 85 2e-14 ref|XP_010905689.1| PREDICTED: nicotinamide adenine dinucleotide... 85 2e-14 ref|XP_010905688.1| PREDICTED: nicotinamide adenine dinucleotide... 85 2e-14 ref|XP_008807764.1| PREDICTED: nicotinamide adenine dinucleotide... 85 2e-14 ref|XP_002302737.1| mitochondrial substrate carrier family prote... 85 2e-14 gb|KDO87106.1| hypothetical protein CISIN_1g021150mg [Citrus sin... 84 3e-14 gb|KDO87105.1| hypothetical protein CISIN_1g021150mg [Citrus sin... 84 3e-14 >ref|XP_011079611.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like [Sesamum indicum] Length = 317 Score = 91.7 bits (226), Expect = 2e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHPQ 228 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVT+FPPDPHPQ Sbjct: 272 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTLFPPDPHPQ 313 >ref|XP_009594055.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic [Nicotiana tomentosiformis] Length = 315 Score = 91.7 bits (226), Expect = 2e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHPQP 225 GFYRGCATNL+RTTPAAVITFTSFEMIHRFLVT+FPPDPHP P Sbjct: 272 GFYRGCATNLIRTTPAAVITFTSFEMIHRFLVTLFPPDPHPHP 314 >ref|XP_012082829.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic [Jatropha curcas] gi|643716581|gb|KDP28207.1| hypothetical protein JCGZ_13978 [Jatropha curcas] Length = 312 Score = 89.7 bits (221), Expect = 7e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHP 231 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVT+FPPDPHP Sbjct: 269 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTLFPPDPHP 309 >ref|XP_010326568.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic [Solanum lycopersicum] Length = 313 Score = 89.0 bits (219), Expect = 1e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHP 231 GFYRGCATNL+RTTPAAVITFTSFEMIHRFLVT+FPPDPHP Sbjct: 270 GFYRGCATNLIRTTPAAVITFTSFEMIHRFLVTMFPPDPHP 310 >ref|XP_006359875.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like [Solanum tuberosum] Length = 316 Score = 89.0 bits (219), Expect = 1e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHP 231 GFYRGCATNL+RTTPAAVITFTSFEMIHRFLVT+FPPDPHP Sbjct: 273 GFYRGCATNLIRTTPAAVITFTSFEMIHRFLVTMFPPDPHP 313 >ref|XP_009784346.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic [Nicotiana sylvestris] gi|583844043|gb|AHI58944.1| chloroplast nicotinamide adenine dinucleotide transporter 1 [Nicotiana tabacum] Length = 315 Score = 88.6 bits (218), Expect = 1e-15 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHPQP 225 GFYRGCATNL+RTTPAAVITFTSFEMIHRFLVT+FP DPHP P Sbjct: 272 GFYRGCATNLIRTTPAAVITFTSFEMIHRFLVTLFPADPHPHP 314 >ref|XP_008451527.1| PREDICTED: LOW QUALITY PROTEIN: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like [Cucumis melo] Length = 311 Score = 87.8 bits (216), Expect = 2e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHP 231 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLV +FPPDPHP Sbjct: 268 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVNLFPPDPHP 308 >ref|XP_012833926.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic [Erythranthe guttatus] gi|848850683|ref|XP_012833933.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic [Erythranthe guttatus] gi|604348612|gb|EYU46767.1| hypothetical protein MIMGU_mgv1a010350mg [Erythranthe guttata] Length = 315 Score = 86.7 bits (213), Expect = 6e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHPQPF 222 GFYRGCATNLLRTTPAAVITFTSFEMIHR L +FPPDPHPQ F Sbjct: 272 GFYRGCATNLLRTTPAAVITFTSFEMIHRSLTDLFPPDPHPQTF 315 >ref|XP_011659376.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic isoform X2 [Cucumis sativus] Length = 303 Score = 86.3 bits (212), Expect = 7e-15 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHP 231 GFYRGCATNLLRTTPAAVITFTSFEMIHRFL +FPPDPHP Sbjct: 260 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLANLFPPDPHP 300 >ref|XP_004136010.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic isoform X1 [Cucumis sativus] gi|700189747|gb|KGN44980.1| hypothetical protein Csa_7G405860 [Cucumis sativus] Length = 311 Score = 86.3 bits (212), Expect = 7e-15 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHP 231 GFYRGCATNLLRTTPAAVITFTSFEMIHRFL +FPPDPHP Sbjct: 268 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLANLFPPDPHP 308 >ref|XP_002273574.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic [Vitis vinifera] gi|297743935|emb|CBI36905.3| unnamed protein product [Vitis vinifera] Length = 315 Score = 85.5 bits (210), Expect = 1e-14 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHP 231 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLV + PPDPHP Sbjct: 272 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVNLLPPDPHP 312 >ref|XP_010259427.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic isoform X2 [Nelumbo nucifera] Length = 245 Score = 85.1 bits (209), Expect = 2e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHP 231 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVT+FPP+P P Sbjct: 202 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTLFPPEPQP 242 >ref|XP_010259426.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic isoform X1 [Nelumbo nucifera] Length = 315 Score = 85.1 bits (209), Expect = 2e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHP 231 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVT+FPP+P P Sbjct: 272 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTLFPPEPQP 312 >ref|XP_011007801.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like [Populus euphratica] Length = 322 Score = 84.7 bits (208), Expect = 2e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHPQ 228 GFYRGCATNL+RTTPAAVITFTSFEMIHRFLVT+ PPDP PQ Sbjct: 279 GFYRGCATNLIRTTPAAVITFTSFEMIHRFLVTLSPPDPQPQ 320 >ref|XP_010905689.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like isoform X2 [Elaeis guineensis] Length = 305 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHP 231 GFYRGCATNLLRTTPAAVITFTSFEMIHRFL+T+FPP+ HP Sbjct: 262 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLITLFPPEQHP 302 >ref|XP_010905688.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like isoform X1 [Elaeis guineensis] Length = 315 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHP 231 GFYRGCATNLLRTTPAAVITFTSFEMIHRFL+T+FPP+ HP Sbjct: 272 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLITLFPPEQHP 312 >ref|XP_008807764.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like [Phoenix dactylifera] Length = 315 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHP 231 GFYRGCATNLLRTTPAAVITFTSFEMIHRFL+T+FPP+ HP Sbjct: 272 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLITLFPPEQHP 312 >ref|XP_002302737.1| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|222844463|gb|EEE82010.1| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 322 Score = 84.7 bits (208), Expect = 2e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHPQ 228 GFYRGCATNL+RTTPAAVITFTSFEMIHRFLVT+ PPDP PQ Sbjct: 279 GFYRGCATNLIRTTPAAVITFTSFEMIHRFLVTLSPPDPQPQ 320 >gb|KDO87106.1| hypothetical protein CISIN_1g021150mg [Citrus sinensis] Length = 241 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHP 231 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLV+ FPPDP P Sbjct: 198 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSYFPPDPQP 238 >gb|KDO87105.1| hypothetical protein CISIN_1g021150mg [Citrus sinensis] Length = 315 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 353 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTVFPPDPHP 231 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLV+ FPPDP P Sbjct: 272 GFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSYFPPDPQP 312