BLASTX nr result
ID: Forsythia23_contig00012968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00012968 (343 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38411.1| hypothetical protein MIMGU_mgv1a021572mg [Erythra... 63 9e-08 >gb|EYU38411.1| hypothetical protein MIMGU_mgv1a021572mg [Erythranthe guttata] Length = 99 Score = 62.8 bits (151), Expect = 9e-08 Identities = 34/58 (58%), Positives = 39/58 (67%), Gaps = 2/58 (3%) Frame = -1 Query: 244 RWIDTSFSLPTSFFRWLRLFTSCFT--PTWSSGFNLSSLTTSLEPRRLASLLRFPDLD 77 RW+D SFSLPTSFFRW RLFTS T P WSS +LS SL+P R A + PD+D Sbjct: 14 RWLDVSFSLPTSFFRWPRLFTSYLTPPPRWSS--SLSLALGSLDPGRWAPRIPLPDVD 69