BLASTX nr result
ID: Forsythia23_contig00012163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00012163 (370 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009622898.1| PREDICTED: 40S ribosomal protein S6 [Nicotia... 85 2e-14 emb|CAA48187.1| ribosomal protein S6 [Nicotiana tabacum] 85 2e-14 sp|P29345.2|RS6_TOBAC RecName: Full=40S ribosomal protein S6, pa... 85 2e-14 gb|EYU30988.1| hypothetical protein MIMGU_mgv1a012493mg [Erythra... 85 2e-14 ref|XP_012845145.1| PREDICTED: 40S ribosomal protein S6 [Erythra... 85 2e-14 ref|XP_010273000.1| PREDICTED: 40S ribosomal protein S6 [Nelumbo... 84 3e-14 ref|XP_008444852.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma... 84 3e-14 ref|XP_006854035.1| PREDICTED: 40S ribosomal protein S6 [Amborel... 84 3e-14 ref|XP_008437828.1| PREDICTED: 40S ribosomal protein S6-like [Cu... 84 4e-14 gb|KDO48241.1| hypothetical protein CISIN_1g025591mg [Citrus sin... 84 4e-14 ref|XP_006421173.1| hypothetical protein CICLE_v10005711mg [Citr... 84 4e-14 ref|XP_004133785.1| PREDICTED: 40S ribosomal protein S6-like [Cu... 84 4e-14 ref|XP_009780041.1| PREDICTED: 40S ribosomal protein S6 [Nicotia... 84 5e-14 ref|XP_006853279.1| PREDICTED: 40S ribosomal protein S6 [Amborel... 84 5e-14 ref|XP_002273865.1| PREDICTED: 40S ribosomal protein S6 isoform ... 84 5e-14 ref|XP_012067901.1| PREDICTED: 40S ribosomal protein S6-like [Ja... 83 6e-14 ref|XP_006842435.1| PREDICTED: 40S ribosomal protein S6 [Amborel... 83 6e-14 ref|XP_009782102.1| PREDICTED: 40S ribosomal protein S6-like [Ni... 83 8e-14 emb|CDP01503.1| unnamed protein product [Coffea canephora] 83 8e-14 ref|XP_008386113.1| PREDICTED: 40S ribosomal protein S6 [Malus d... 83 8e-14 >ref|XP_009622898.1| PREDICTED: 40S ribosomal protein S6 [Nicotiana tomentosiformis] Length = 249 Score = 85.1 bits (209), Expect = 2e-14 Identities = 46/48 (95%), Positives = 46/48 (95%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPS A Sbjct: 202 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSIAA 249 >emb|CAA48187.1| ribosomal protein S6 [Nicotiana tabacum] Length = 192 Score = 85.1 bits (209), Expect = 2e-14 Identities = 46/48 (95%), Positives = 46/48 (95%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPS A Sbjct: 145 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSIAA 192 >sp|P29345.2|RS6_TOBAC RecName: Full=40S ribosomal protein S6, partial [Nicotiana tabacum] Length = 199 Score = 85.1 bits (209), Expect = 2e-14 Identities = 46/48 (95%), Positives = 46/48 (95%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPS A Sbjct: 152 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSIAA 199 >gb|EYU30988.1| hypothetical protein MIMGU_mgv1a012493mg [Erythranthe guttata] Length = 248 Score = 84.7 bits (208), Expect = 2e-14 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAKSEAA+YQKLLASRLKEQREKRSESLAKKRSRLSAASKPS +A Sbjct: 201 RIAKAKSEAADYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSIVA 248 >ref|XP_012845145.1| PREDICTED: 40S ribosomal protein S6 [Erythranthe guttatus] gi|604319823|gb|EYU30987.1| hypothetical protein MIMGU_mgv1a012493mg [Erythranthe guttata] Length = 249 Score = 84.7 bits (208), Expect = 2e-14 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAKSEAA+YQKLLASRLKEQREKRSESLAKKRSRLSAASKPS +A Sbjct: 202 RIAKAKSEAADYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSIVA 249 >ref|XP_010273000.1| PREDICTED: 40S ribosomal protein S6 [Nelumbo nucifera] gi|720054285|ref|XP_010273001.1| PREDICTED: 40S ribosomal protein S6 [Nelumbo nucifera] Length = 249 Score = 84.3 bits (207), Expect = 3e-14 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAKSEAAEYQKLLASRLKEQRE+RSESLAKKRSRLSAASKPS A Sbjct: 202 RIAKAKSEAAEYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSVAA 249 >ref|XP_008444852.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S6-like [Cucumis melo] Length = 249 Score = 84.3 bits (207), Expect = 3e-14 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAKSEAAEYQKLLASRLKEQRE+RSESLAKKRSRLSAASKPS A Sbjct: 202 RIAKAKSEAAEYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSVAA 249 >ref|XP_006854035.1| PREDICTED: 40S ribosomal protein S6 [Amborella trichopoda] gi|548857704|gb|ERN15502.1| hypothetical protein AMTR_s00048p00058600 [Amborella trichopoda] Length = 249 Score = 84.3 bits (207), Expect = 3e-14 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAKSEAAEYQKLLASRLKEQRE+RSESLAKKRSRLSAASKPS A Sbjct: 202 RIAKAKSEAAEYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSVAA 249 >ref|XP_008437828.1| PREDICTED: 40S ribosomal protein S6-like [Cucumis melo] Length = 250 Score = 84.0 bits (206), Expect = 4e-14 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAKSEAAEYQKLLASRLKEQRE+RSESLAKKRSRLSAASKPS A Sbjct: 202 RIAKAKSEAAEYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >gb|KDO48241.1| hypothetical protein CISIN_1g025591mg [Citrus sinensis] Length = 198 Score = 84.0 bits (206), Expect = 4e-14 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAK+EAAEYQKLLA+RLKEQRE+RSESLAKKRSRLSAASKPST A Sbjct: 150 RIAKAKAEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 197 >ref|XP_006421173.1| hypothetical protein CICLE_v10005711mg [Citrus clementina] gi|568876868|ref|XP_006491492.1| PREDICTED: 40S ribosomal protein S6-like [Citrus sinensis] gi|557523046|gb|ESR34413.1| hypothetical protein CICLE_v10005711mg [Citrus clementina] gi|641829113|gb|KDO48240.1| hypothetical protein CISIN_1g025591mg [Citrus sinensis] Length = 250 Score = 84.0 bits (206), Expect = 4e-14 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAK+EAAEYQKLLA+RLKEQRE+RSESLAKKRSRLSAASKPST A Sbjct: 202 RIAKAKAEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 249 >ref|XP_004133785.1| PREDICTED: 40S ribosomal protein S6-like [Cucumis sativus] gi|700201246|gb|KGN56379.1| hypothetical protein Csa_3G118140 [Cucumis sativus] Length = 250 Score = 84.0 bits (206), Expect = 4e-14 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAKSEAAEYQKLLASRLKEQRE+RSESLAKKRSRLSAASKPS A Sbjct: 202 RIAKAKSEAAEYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >ref|XP_009780041.1| PREDICTED: 40S ribosomal protein S6 [Nicotiana sylvestris] Length = 249 Score = 83.6 bits (205), Expect = 5e-14 Identities = 45/48 (93%), Positives = 45/48 (93%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RI KAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPS A Sbjct: 202 RIVKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSIAA 249 >ref|XP_006853279.1| PREDICTED: 40S ribosomal protein S6 [Amborella trichopoda] gi|548856918|gb|ERN14746.1| hypothetical protein AMTR_s00038p00238890 [Amborella trichopoda] Length = 249 Score = 83.6 bits (205), Expect = 5e-14 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAKSEAAEYQKLLASR+KEQRE+RSESLAKKRSRLSAASKPS A Sbjct: 202 RIAKAKSEAAEYQKLLASRIKEQRERRSESLAKKRSRLSAASKPSVAA 249 >ref|XP_002273865.1| PREDICTED: 40S ribosomal protein S6 isoform X1 [Vitis vinifera] gi|731396851|ref|XP_010652675.1| PREDICTED: 40S ribosomal protein S6 isoform X1 [Vitis vinifera] gi|731396853|ref|XP_010652676.1| PREDICTED: 40S ribosomal protein S6 isoform X1 [Vitis vinifera] gi|731396855|ref|XP_010652677.1| PREDICTED: 40S ribosomal protein S6 isoform X2 [Vitis vinifera] gi|297741825|emb|CBI33138.3| unnamed protein product [Vitis vinifera] Length = 249 Score = 83.6 bits (205), Expect = 5e-14 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAKSEAAEYQKLLA+RLKEQRE+RSESLAKKRSRLSAASKPS +A Sbjct: 202 RIAKAKSEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSIVA 249 >ref|XP_012067901.1| PREDICTED: 40S ribosomal protein S6-like [Jatropha curcas] gi|643734740|gb|KDP41410.1| hypothetical protein JCGZ_15817 [Jatropha curcas] Length = 249 Score = 83.2 bits (204), Expect = 6e-14 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAKSEAAEYQKLLA+RLKEQRE+RSESLAKKRSRLSAASKPS A Sbjct: 202 RIAKAKSEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 249 >ref|XP_006842435.1| PREDICTED: 40S ribosomal protein S6 [Amborella trichopoda] gi|548844521|gb|ERN04110.1| hypothetical protein AMTR_s00077p00035710 [Amborella trichopoda] Length = 249 Score = 83.2 bits (204), Expect = 6e-14 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAK+EAAEYQKLLASRLKEQRE+RSESLAKKRSRLSAASKPS A Sbjct: 202 RIAKAKAEAAEYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSVAA 249 >ref|XP_009782102.1| PREDICTED: 40S ribosomal protein S6-like [Nicotiana sylvestris] Length = 249 Score = 82.8 bits (203), Expect = 8e-14 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAKSEAAEYQKLLA+RLKEQRE+RSESLAKKRSRLSAASKPS A Sbjct: 202 RIAKAKSEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSITA 249 >emb|CDP01503.1| unnamed protein product [Coffea canephora] Length = 249 Score = 82.8 bits (203), Expect = 8e-14 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 RIAKAKSEAAEYQKLLA+RLKEQRE+RSESLAKKRSRLSAASKPS A Sbjct: 202 RIAKAKSEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >ref|XP_008386113.1| PREDICTED: 40S ribosomal protein S6 [Malus domestica] Length = 249 Score = 82.8 bits (203), Expect = 8e-14 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = -3 Query: 368 RIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSTLA 225 R+AKAKSEAAEYQKLLASRLKEQR++RSESLAKKRSRLSAASKPS A Sbjct: 202 RVAKAKSEAAEYQKLLASRLKEQRDRRSESLAKKRSRLSAASKPSVAA 249