BLASTX nr result
ID: Forsythia23_contig00012105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00012105 (332 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011092174.1| PREDICTED: uncharacterized protein LOC105172... 62 2e-07 ref|XP_012835901.1| PREDICTED: uncharacterized protein LOC105956... 61 3e-07 >ref|XP_011092174.1| PREDICTED: uncharacterized protein LOC105172443 [Sesamum indicum] Length = 317 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +2 Query: 143 MASTDEDITAQYFKKGSAVEISSNDEGFRGSWFEGTVIRPP 265 MA++ D +QYFKKG+ VEISS++EGFRGSW+ TV+RPP Sbjct: 1 MAASSRDSISQYFKKGAEVEISSDEEGFRGSWYAATVVRPP 41 >ref|XP_012835901.1| PREDICTED: uncharacterized protein LOC105956595 [Erythranthe guttatus] gi|604334324|gb|EYU38408.1| hypothetical protein MIMGU_mgv1a009346mg [Erythranthe guttata] Length = 345 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = +2 Query: 143 MASTDEDITAQYFKKGSAVEISSNDEGFRGSWFEGTVIRPPPETTT 280 MA + D+ +QYFKKG+ VEISS++EGFRGS + GTVIRPP T+ Sbjct: 1 MAGVNADLISQYFKKGADVEISSDEEGFRGSLYAGTVIRPPGNLTS 46