BLASTX nr result
ID: Forsythia23_contig00011597
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00011597 (571 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080180.1| PREDICTED: guanine nucleotide-binding protei... 72 1e-10 emb|CDP03856.1| unnamed protein product [Coffea canephora] 67 4e-09 ref|XP_006364266.1| PREDICTED: guanine nucleotide-binding protei... 67 7e-09 ref|XP_009788644.1| PREDICTED: guanine nucleotide-binding protei... 64 4e-08 ref|XP_004242396.1| PREDICTED: guanine nucleotide-binding protei... 64 6e-08 ref|NP_001234382.1| nuclear GTPase-like [Solanum lycopersicum] g... 61 3e-07 ref|XP_009612778.1| PREDICTED: guanine nucleotide-binding protei... 59 2e-06 ref|XP_012828985.1| PREDICTED: guanine nucleotide-binding protei... 56 1e-05 >ref|XP_011080180.1| PREDICTED: guanine nucleotide-binding protein-like NSN1 [Sesamum indicum] Length = 601 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/56 (60%), Positives = 46/56 (82%), Gaps = 1/56 (1%) Frame = -2 Query: 531 NQSSAMEDDMNNDYDFKVDYVKRESAMEVGN-EDGKADNTNQNKFELPSGVELDND 367 NQ +AME D N+DYDFKVDYVKR+SAM+ + E+ A +++N+FELPSGVE+DN+ Sbjct: 546 NQPAAMEHDSNDDYDFKVDYVKRDSAMDTSDGENDVAGESSKNRFELPSGVEVDNE 601 >emb|CDP03856.1| unnamed protein product [Coffea canephora] Length = 598 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/55 (58%), Positives = 44/55 (80%) Frame = -2 Query: 531 NQSSAMEDDMNNDYDFKVDYVKRESAMEVGNEDGKADNTNQNKFELPSGVELDND 367 N+S+AMEDD YDFKVDYV + SAME+G G D++++N+FELPSGV+L+N+ Sbjct: 548 NKSTAMEDD----YDFKVDYVSKGSAMEIGEGVGLEDDSSKNRFELPSGVDLENE 598 >ref|XP_006364266.1| PREDICTED: guanine nucleotide-binding protein-like 3 homolog [Solanum tuberosum] Length = 608 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -2 Query: 507 DMNNDYDFKVDYVKRESAMEVGNEDGKADNTNQNKFELPSGVELDND 367 DM+ DYDFKVDY+K++SAM+ NE D + N+FELPSGVELDN+ Sbjct: 562 DMDGDYDFKVDYIKKDSAMDDANEVVATDESKNNRFELPSGVELDNE 608 >ref|XP_009788644.1| PREDICTED: guanine nucleotide-binding protein-like 3 homolog [Nicotiana sylvestris] Length = 611 Score = 64.3 bits (155), Expect = 4e-08 Identities = 28/55 (50%), Positives = 40/55 (72%) Frame = -2 Query: 531 NQSSAMEDDMNNDYDFKVDYVKRESAMEVGNEDGKADNTNQNKFELPSGVELDND 367 ++ S D M++DYDFKVDYVK++SAM+ + D + N+FELPSGV+LDN+ Sbjct: 557 DKPSTASDMMDDDYDFKVDYVKKDSAMDDAEDTETTDGSKNNRFELPSGVDLDNE 611 >ref|XP_004242396.1| PREDICTED: guanine nucleotide-binding protein-like 3 homolog [Solanum lycopersicum] Length = 605 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/55 (50%), Positives = 41/55 (74%) Frame = -2 Query: 531 NQSSAMEDDMNNDYDFKVDYVKRESAMEVGNEDGKADNTNQNKFELPSGVELDND 367 +++S D M++DYDFKVDY K+ESAM+ +D + + +N+FELPSG ELDN+ Sbjct: 551 DRASTTSDMMDSDYDFKVDYFKKESAMDDAEDDMPVNESKKNRFELPSGNELDNE 605 >ref|NP_001234382.1| nuclear GTPase-like [Solanum lycopersicum] gi|83630757|gb|ABC26876.1| putative nuclear GTPase [Solanum lycopersicum] Length = 609 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = -2 Query: 507 DMNNDYDFKVDYVKRESAMEVGNEDGKADNTNQNKFELPSGVELDND 367 DM+ DYDFKVDY+K++SAM+ +E D + N+FELPSG +LDN+ Sbjct: 563 DMDGDYDFKVDYIKKDSAMDDADEVVATDESKNNRFELPSGFKLDNE 609 >ref|XP_009612778.1| PREDICTED: guanine nucleotide-binding protein-like 3 homolog [Nicotiana tomentosiformis] Length = 605 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/57 (47%), Positives = 41/57 (71%), Gaps = 2/57 (3%) Frame = -2 Query: 531 NQSSAMEDDMNNDYDFKVDYVKRESAMEVGNEDGKADNTNQNKFELPSGV--ELDND 367 +++S D M++DYDFKVDY K+ES M+ +D D + +N+FE+PSG+ ELDN+ Sbjct: 549 DKASTTSDMMDDDYDFKVDYFKKESIMDDAEDDVIIDESKKNRFEIPSGIGNELDNE 605 >ref|XP_012828985.1| PREDICTED: guanine nucleotide-binding protein-like NSN1 [Erythranthe guttatus] gi|604297864|gb|EYU17983.1| hypothetical protein MIMGU_mgv1a003533mg [Erythranthe guttata] Length = 579 Score = 56.2 bits (134), Expect = 1e-05 Identities = 28/54 (51%), Positives = 37/54 (68%) Frame = -2 Query: 528 QSSAMEDDMNNDYDFKVDYVKRESAMEVGNEDGKADNTNQNKFELPSGVELDND 367 Q+ A E D N+DYDFKVDYVK+ SAM+ G+ N+NK ELPS V++D + Sbjct: 530 QTPAKEGDGNDDYDFKVDYVKKSSAMDTDEVGGE----NENKVELPSVVDMDKE 579