BLASTX nr result
ID: Forsythia23_contig00011423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00011423 (560 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012832799.1| PREDICTED: uncharacterized transporter YBR28... 136 7e-30 gb|EYU41206.1| hypothetical protein MIMGU_mgv1a018588mg [Erythra... 136 7e-30 ref|XP_010266292.1| PREDICTED: uncharacterized transporter YBR28... 134 3e-29 ref|XP_011099968.1| PREDICTED: uncharacterized transporter C5D6.... 133 4e-29 ref|XP_011038093.1| PREDICTED: uncharacterized transporter YBR28... 133 6e-29 ref|XP_011038092.1| PREDICTED: uncharacterized transporter YBR28... 133 6e-29 ref|XP_006370746.1| hypothetical protein POPTR_0001s46050g [Popu... 133 6e-29 ref|XP_009798619.1| PREDICTED: uncharacterized transporter YBR28... 131 2e-28 ref|XP_009798616.1| PREDICTED: uncharacterized transporter YBR28... 131 2e-28 ref|XP_009592449.1| PREDICTED: uncharacterized transporter YBR28... 131 2e-28 ref|XP_009592390.1| PREDICTED: uncharacterized transporter YBR28... 131 2e-28 ref|XP_009592191.1| PREDICTED: uncharacterized transporter YBR28... 131 2e-28 ref|XP_010033614.1| PREDICTED: uncharacterized transporter C5D6.... 130 5e-28 ref|XP_004238466.1| PREDICTED: uncharacterized transporter YBR28... 129 1e-27 ref|XP_011100000.1| PREDICTED: uncharacterized transporter YBR28... 128 1e-27 ref|XP_011099988.1| PREDICTED: uncharacterized transporter YBR28... 128 1e-27 ref|XP_006342188.1| PREDICTED: uncharacterized transporter YBR28... 128 1e-27 ref|XP_002528528.1| auxin:hydrogen symporter, putative [Ricinus ... 127 4e-27 ref|XP_010094502.1| Uncharacterized transporter [Morus notabilis... 126 5e-27 ref|XP_006599270.1| PREDICTED: uncharacterized protein LOC100817... 126 5e-27 >ref|XP_012832799.1| PREDICTED: uncharacterized transporter YBR287W [Erythranthe guttatus] Length = 422 Score = 136 bits (342), Expect = 7e-30 Identities = 61/75 (81%), Positives = 71/75 (94%) Frame = -1 Query: 560 VVVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLAS 381 V+V+GA+ FG+VH NPLYQFVLLLQFALPPAMNIGT++QLFGAGESECSVIMLWCY LAS Sbjct: 348 VIVQGAIRFGIVHDNPLYQFVLLLQFALPPAMNIGTITQLFGAGESECSVIMLWCYLLAS 407 Query: 380 ITVTLWSTLFLWLVA 336 + +T+WSTLFLWLV+ Sbjct: 408 VALTVWSTLFLWLVS 422 >gb|EYU41206.1| hypothetical protein MIMGU_mgv1a018588mg [Erythranthe guttata] Length = 341 Score = 136 bits (342), Expect = 7e-30 Identities = 61/75 (81%), Positives = 71/75 (94%) Frame = -1 Query: 560 VVVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLAS 381 V+V+GA+ FG+VH NPLYQFVLLLQFALPPAMNIGT++QLFGAGESECSVIMLWCY LAS Sbjct: 267 VIVQGAIRFGIVHDNPLYQFVLLLQFALPPAMNIGTITQLFGAGESECSVIMLWCYLLAS 326 Query: 380 ITVTLWSTLFLWLVA 336 + +T+WSTLFLWLV+ Sbjct: 327 VALTVWSTLFLWLVS 341 >ref|XP_010266292.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo nucifera] gi|720033008|ref|XP_010266293.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo nucifera] gi|720033011|ref|XP_010266294.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo nucifera] gi|720033014|ref|XP_010266295.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo nucifera] gi|720033018|ref|XP_010266296.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo nucifera] gi|720033021|ref|XP_010266297.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo nucifera] Length = 418 Score = 134 bits (337), Expect = 3e-29 Identities = 61/75 (81%), Positives = 70/75 (93%) Frame = -1 Query: 560 VVVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLAS 381 V+VKGA+HFG VH +PLYQF+LLLQFALPPAMNIGTM+QLFG G+SECSVIMLW Y LAS Sbjct: 344 VIVKGAIHFGWVHSDPLYQFILLLQFALPPAMNIGTMTQLFGEGQSECSVIMLWTYALAS 403 Query: 380 ITVTLWSTLFLWLVA 336 I++TLWSTLF+WLVA Sbjct: 404 ISLTLWSTLFMWLVA 418 >ref|XP_011099968.1| PREDICTED: uncharacterized transporter C5D6.04-like [Sesamum indicum] gi|747046500|ref|XP_011099976.1| PREDICTED: uncharacterized transporter C5D6.04-like [Sesamum indicum] Length = 393 Score = 133 bits (335), Expect = 4e-29 Identities = 60/74 (81%), Positives = 71/74 (95%) Frame = -1 Query: 557 VVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLASI 378 VVKGAL FGL+H++PLY FVLLLQF+LPPAMNIGT++QLFG GESECSVIMLWCYTLAS+ Sbjct: 320 VVKGALRFGLIHNDPLYLFVLLLQFSLPPAMNIGTITQLFGVGESECSVIMLWCYTLASL 379 Query: 377 TVTLWSTLFLWLVA 336 ++TLWST+FLWLV+ Sbjct: 380 SLTLWSTVFLWLVS 393 >ref|XP_011038093.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 [Populus euphratica] Length = 346 Score = 133 bits (334), Expect = 6e-29 Identities = 61/74 (82%), Positives = 70/74 (94%) Frame = -1 Query: 557 VVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLASI 378 +VKGA+HFGLVH +PLYQFVLLLQFA+PPA+NIGT++QLFGAGESECSVIMLW Y LASI Sbjct: 273 IVKGAVHFGLVHSDPLYQFVLLLQFAVPPALNIGTITQLFGAGESECSVIMLWTYALASI 332 Query: 377 TVTLWSTLFLWLVA 336 +TLWSTLF+WLVA Sbjct: 333 FLTLWSTLFMWLVA 346 >ref|XP_011038092.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 [Populus euphratica] Length = 420 Score = 133 bits (334), Expect = 6e-29 Identities = 61/74 (82%), Positives = 70/74 (94%) Frame = -1 Query: 557 VVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLASI 378 +VKGA+HFGLVH +PLYQFVLLLQFA+PPA+NIGT++QLFGAGESECSVIMLW Y LASI Sbjct: 347 IVKGAVHFGLVHSDPLYQFVLLLQFAVPPALNIGTITQLFGAGESECSVIMLWTYALASI 406 Query: 377 TVTLWSTLFLWLVA 336 +TLWSTLF+WLVA Sbjct: 407 FLTLWSTLFMWLVA 420 >ref|XP_006370746.1| hypothetical protein POPTR_0001s46050g [Populus trichocarpa] gi|550349991|gb|ERP67315.1| hypothetical protein POPTR_0001s46050g [Populus trichocarpa] Length = 428 Score = 133 bits (334), Expect = 6e-29 Identities = 61/74 (82%), Positives = 70/74 (94%) Frame = -1 Query: 557 VVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLASI 378 +VKGA+HFGLVH +PLYQFVLLLQFA+PPA+NIGT++QLFGAGESECSVIMLW Y LASI Sbjct: 355 IVKGAVHFGLVHSDPLYQFVLLLQFAVPPALNIGTITQLFGAGESECSVIMLWTYALASI 414 Query: 377 TVTLWSTLFLWLVA 336 +TLWSTLF+WLVA Sbjct: 415 FLTLWSTLFMWLVA 428 >ref|XP_009798619.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 [Nicotiana sylvestris] Length = 350 Score = 131 bits (329), Expect = 2e-28 Identities = 59/74 (79%), Positives = 68/74 (91%) Frame = -1 Query: 557 VVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLASI 378 VVKGA+H GLV H+PLYQFVLLLQFALPPAMNIGT++QLFGAGESECSVIM W Y LAS+ Sbjct: 277 VVKGAIHLGLVQHDPLYQFVLLLQFALPPAMNIGTITQLFGAGESECSVIMFWAYALASV 336 Query: 377 TVTLWSTLFLWLVA 336 ++TLW+T F+WLVA Sbjct: 337 SLTLWTTFFMWLVA 350 >ref|XP_009798616.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 [Nicotiana sylvestris] gi|698506456|ref|XP_009798617.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 [Nicotiana sylvestris] gi|698506458|ref|XP_009798618.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 [Nicotiana sylvestris] Length = 418 Score = 131 bits (329), Expect = 2e-28 Identities = 59/74 (79%), Positives = 68/74 (91%) Frame = -1 Query: 557 VVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLASI 378 VVKGA+H GLV H+PLYQFVLLLQFALPPAMNIGT++QLFGAGESECSVIM W Y LAS+ Sbjct: 345 VVKGAIHLGLVQHDPLYQFVLLLQFALPPAMNIGTITQLFGAGESECSVIMFWAYALASV 404 Query: 377 TVTLWSTLFLWLVA 336 ++TLW+T F+WLVA Sbjct: 405 SLTLWTTFFMWLVA 418 >ref|XP_009592449.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X3 [Nicotiana tomentosiformis] Length = 350 Score = 131 bits (329), Expect = 2e-28 Identities = 59/74 (79%), Positives = 68/74 (91%) Frame = -1 Query: 557 VVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLASI 378 VVKGA+H GLV H+PLYQFVLLLQFALPPAMNIGT++QLFGAGESECSVIM W Y LAS+ Sbjct: 277 VVKGAIHLGLVQHDPLYQFVLLLQFALPPAMNIGTITQLFGAGESECSVIMFWAYALASV 336 Query: 377 TVTLWSTLFLWLVA 336 ++TLW+T F+WLVA Sbjct: 337 SLTLWTTFFMWLVA 350 >ref|XP_009592390.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 [Nicotiana tomentosiformis] Length = 374 Score = 131 bits (329), Expect = 2e-28 Identities = 59/74 (79%), Positives = 68/74 (91%) Frame = -1 Query: 557 VVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLASI 378 VVKGA+H GLV H+PLYQFVLLLQFALPPAMNIGT++QLFGAGESECSVIM W Y LAS+ Sbjct: 301 VVKGAIHLGLVQHDPLYQFVLLLQFALPPAMNIGTITQLFGAGESECSVIMFWAYALASV 360 Query: 377 TVTLWSTLFLWLVA 336 ++TLW+T F+WLVA Sbjct: 361 SLTLWTTFFMWLVA 374 >ref|XP_009592191.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 [Nicotiana tomentosiformis] gi|697093974|ref|XP_009592265.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 [Nicotiana tomentosiformis] gi|697093976|ref|XP_009592327.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 [Nicotiana tomentosiformis] Length = 418 Score = 131 bits (329), Expect = 2e-28 Identities = 59/74 (79%), Positives = 68/74 (91%) Frame = -1 Query: 557 VVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLASI 378 VVKGA+H GLV H+PLYQFVLLLQFALPPAMNIGT++QLFGAGESECSVIM W Y LAS+ Sbjct: 345 VVKGAIHLGLVQHDPLYQFVLLLQFALPPAMNIGTITQLFGAGESECSVIMFWAYALASV 404 Query: 377 TVTLWSTLFLWLVA 336 ++TLW+T F+WLVA Sbjct: 405 SLTLWTTFFMWLVA 418 >ref|XP_010033614.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus grandis] gi|702482852|ref|XP_010033615.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus grandis] gi|702482856|ref|XP_010033616.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus grandis] gi|702482860|ref|XP_010033617.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus grandis] gi|629086958|gb|KCW53315.1| hypothetical protein EUGRSUZ_J02568 [Eucalyptus grandis] Length = 418 Score = 130 bits (326), Expect = 5e-28 Identities = 59/74 (79%), Positives = 68/74 (91%) Frame = -1 Query: 557 VVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLASI 378 +VKGAL+FGLVH +PLY FVLLLQ+ALPPAMNIGTM+QLFGAGESECSV+MLW Y LASI Sbjct: 345 IVKGALYFGLVHEDPLYLFVLLLQYALPPAMNIGTMTQLFGAGESECSVVMLWTYALASI 404 Query: 377 TVTLWSTLFLWLVA 336 +T+WST F+WLVA Sbjct: 405 ALTVWSTFFMWLVA 418 >ref|XP_004238466.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum lycopersicum] gi|723696443|ref|XP_010320486.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum lycopersicum] gi|723696446|ref|XP_010320487.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum lycopersicum] Length = 407 Score = 129 bits (323), Expect = 1e-27 Identities = 59/75 (78%), Positives = 68/75 (90%) Frame = -1 Query: 560 VVVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLAS 381 VVVKGA+ GLV H+PLYQFVLLLQFALPPAMNIGT++QLFGAGESECSVIM W Y LAS Sbjct: 333 VVVKGAIRLGLVQHDPLYQFVLLLQFALPPAMNIGTITQLFGAGESECSVIMFWAYALAS 392 Query: 380 ITVTLWSTLFLWLVA 336 I++TLW+T F+WLV+ Sbjct: 393 ISLTLWTTFFMWLVS 407 >ref|XP_011100000.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 [Sesamum indicum] Length = 416 Score = 128 bits (322), Expect = 1e-27 Identities = 60/74 (81%), Positives = 66/74 (89%) Frame = -1 Query: 557 VVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLASI 378 VVKGA GLVH NPLY+FVLLLQF+LPPAMNIGTM+QLFG GESECSVIMLWCY LAS+ Sbjct: 343 VVKGAQKLGLVHDNPLYRFVLLLQFSLPPAMNIGTMTQLFGLGESECSVIMLWCYALASV 402 Query: 377 TVTLWSTLFLWLVA 336 +TLWS LFLWLV+ Sbjct: 403 FLTLWSMLFLWLVS 416 >ref|XP_011099988.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 [Sesamum indicum] Length = 417 Score = 128 bits (322), Expect = 1e-27 Identities = 60/74 (81%), Positives = 66/74 (89%) Frame = -1 Query: 557 VVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLASI 378 VVKGA GLVH NPLY+FVLLLQF+LPPAMNIGTM+QLFG GESECSVIMLWCY LAS+ Sbjct: 344 VVKGAQKLGLVHDNPLYRFVLLLQFSLPPAMNIGTMTQLFGLGESECSVIMLWCYALASV 403 Query: 377 TVTLWSTLFLWLVA 336 +TLWS LFLWLV+ Sbjct: 404 FLTLWSMLFLWLVS 417 >ref|XP_006342188.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 [Solanum tuberosum] gi|565350464|ref|XP_006342189.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 [Solanum tuberosum] Length = 407 Score = 128 bits (322), Expect = 1e-27 Identities = 59/75 (78%), Positives = 67/75 (89%) Frame = -1 Query: 560 VVVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLAS 381 VVVKGA+ GLV H+PLYQFVLLLQFALPPAMNIGT++QLFGAGESECSVIM W Y LAS Sbjct: 333 VVVKGAIRLGLVQHDPLYQFVLLLQFALPPAMNIGTITQLFGAGESECSVIMFWAYALAS 392 Query: 380 ITVTLWSTLFLWLVA 336 I +TLW+T F+WLV+ Sbjct: 393 IALTLWTTFFMWLVS 407 >ref|XP_002528528.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223532030|gb|EEF33840.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 417 Score = 127 bits (318), Expect = 4e-27 Identities = 56/74 (75%), Positives = 69/74 (93%) Frame = -1 Query: 560 VVVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLAS 381 V+V+GA+HFGLV +PLYQF+LL+QFA+PPAMNIGTM+QLFG G+SECSVIMLW Y +AS Sbjct: 343 VIVRGAVHFGLVGSDPLYQFILLVQFAVPPAMNIGTMTQLFGTGQSECSVIMLWTYAMAS 402 Query: 380 ITVTLWSTLFLWLV 339 I++TLWSTLFLW+V Sbjct: 403 ISLTLWSTLFLWMV 416 >ref|XP_010094502.1| Uncharacterized transporter [Morus notabilis] gi|587866818|gb|EXB56256.1| Uncharacterized transporter [Morus notabilis] Length = 420 Score = 126 bits (317), Expect = 5e-27 Identities = 59/75 (78%), Positives = 69/75 (92%) Frame = -1 Query: 560 VVVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLAS 381 +VVKGA+HFG+V +PLYQFVLLLQFALPPAMNIGT++QLFGAGESECSVIMLW Y LAS Sbjct: 346 LVVKGAIHFGMVQSDPLYQFVLLLQFALPPAMNIGTITQLFGAGESECSVIMLWTYALAS 405 Query: 380 ITVTLWSTLFLWLVA 336 I++T WST+F+ LVA Sbjct: 406 ISLTFWSTIFMLLVA 420 >ref|XP_006599270.1| PREDICTED: uncharacterized protein LOC100817605 isoform X5 [Glycine max] Length = 340 Score = 126 bits (317), Expect = 5e-27 Identities = 58/73 (79%), Positives = 66/73 (90%) Frame = -1 Query: 557 VVKGALHFGLVHHNPLYQFVLLLQFALPPAMNIGTMSQLFGAGESECSVIMLWCYTLASI 378 VVKGA+HF LVH + LYQFVLLLQ+ALPPAMNIGT++QLFGAGESECSVIMLW Y LA++ Sbjct: 267 VVKGAIHFSLVHSDALYQFVLLLQYALPPAMNIGTIAQLFGAGESECSVIMLWTYILAAV 326 Query: 377 TVTLWSTLFLWLV 339 VTLWST F+WLV Sbjct: 327 AVTLWSTFFMWLV 339